SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284929222|ref|YP_003421744.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929222|ref|YP_003421744.1|
Domain Number 1 Region: 201-366
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.38e-43
Family Histidine kinase 0.0011
Further Details:      
 
Domain Number 2 Region: 2-88
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.1e-26
Family KaiB-like 0.00082
Further Details:      
 
Domain Number 3 Region: 126-209
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000353
Family Homodimeric domain of signal transducing histidine kinase 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284929222|ref|YP_003421744.1|
Sequence length 368
Comment histidine kinase,KaiB domain-containing protein,histidine kinase [cyanobacterium UCYN-A]
Sequence
MSIELLLFIDERPRSNKCVKLIQDYIEFIKKSCPCQLEVIEIHEQPHLVEHFRLVATPTL
IKVSPGPKQTLAGSNLINQLERWWPQWKILLEEKYSDCETKEDTTTIGLIKYSAELIRLS
DEVFRLKKEKKNLLDQLNFKDQVLAMLAHDLRSPLTATSIAIDTLAIVQDKEVNESCTKL
KKQLFFQTYNQLQIMNRLITDILQASKSMNGELKVERTEVFLSRLFKEIFKQYINSLKEK
SINFIEDIPEDIPAVYADEELIRQVIINLLDNAVKYTPKNGTITLSILHRTSQKIQVSIS
DTGPGIPKEKKERIFEGHFRLQRDLKKEGYGLGLSLCRKIIRVHYGQIWVDSMLKQGSCF
HFTLPVYR
Download sequence
Identical sequences D3EPG3
WP_012954050.1.87152 gi|284929222|ref|YP_003421744.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]