SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284929565|ref|YP_003422087.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929565|ref|YP_003422087.1|
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily Ribosomal protein S19 3.92e-35
Family Ribosomal protein S19 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284929565|ref|YP_003422087.1|
Sequence length 93
Comment 30S ribosomal protein S19P [cyanobacterium UCYN-A]
Sequence
MSRSLKKGPFISDSLLTKIEKLNEKGDKQVIRTWSRASTIVPVMIGHTIAVHNGKQHIPV
FISEQMVGHKLGEFSPTRTFRGHAKSDKKSGRR
Download sequence
Identical sequences D3EQF6
WP_012954393.1.87152 gi|284929565|ref|YP_003422087.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]