SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284929567|ref|YP_003422089.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929567|ref|YP_003422089.1|
Domain Number 1 Region: 111-208
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 3.66e-38
Family Ribosomal protein S3 C-terminal domain 0.0000145
Further Details:      
 
Domain Number 2 Region: 2-108
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.6e-36
Family Prokaryotic type KH domain (KH-domain type II) 0.0000438
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284929567|ref|YP_003422089.1|
Sequence length 240
Comment 30S ribosomal protein S3P [cyanobacterium UCYN-A]
Sequence
MGQKIHPIGFRLGITKEHKSRWYADKRRYPELLQEDLAVRKHIEKNLSNAGIADIRIERK
ADQIDLAIHTARPGVVVGRGGSGIEQLRTALQKNLGENRQIRINVIEVSRVDADAALIAE
YITQQLERRVSFRRVVRQAIQRAQRAEVKGIKIQVGGRLNGAEIARSEWVREGRVPLHTL
RADIDYSYRTAQTTYGILGVKVWVFKGEIIPGQEEQTTTSAPPTPKRNRRKQFEDRSNEE
Download sequence
Identical sequences D3EQF8
WP_012954395.1.87152 gi|284929567|ref|YP_003422089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]