SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|471261014|ref|YP_007643869.1| from Bdellovibrio exovorus JSS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471261014|ref|YP_007643869.1|
Domain Number 1 Region: 341-394
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000262
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 281-332
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000131
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Weak hits

Sequence:  gi|471261014|ref|YP_007643869.1|
Domain Number - Region: 22-112
Classification Level Classification E-value
Superfamily Pili subunits 0.00235
Family Pilin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|471261014|ref|YP_007643869.1|
Sequence length 593
Comment hypothetical protein A11Q_42 [Bdellovibrio exovorus JSS]
Sequence
MRNVQRWWNIKKLFFINNRGVSLIQLMVAVALGAVVSLAVINMMSFSTQEQKKVQLRDEL
LKLKNSFSEILQQNQAIQNTINASVNANMACLRNRTTCATSLVASAYSPSLDRIVLYNSG
TGGGQVFYDGRTTSSAGFTEKGTKCSGFSPTGAGNDNCPIGYIINWYVNEAASTSGLTLT
INAKMVFNPSDNHLMKNFINARAGDTKVGSYDVTISRRVLSLTDLNVVTCDQNGINLSHS
AAYTFYATPSVPTGSRCQQETRVCSVVNNTASLSGSYTNPTCTQNCSGNWGACSVMCGGG
TQTYTVDVPANQWGAACPHVDGETRTCNTAACAPPSTPVNCAGDWSAWSSCSASCGGGTQ
TRTYTVTTPAANGGTACPATNGQTQSQSCNPQSCGAPVDCVGAWTPCLTSSGNSTYVVTT
PAANGGAACSVPEGTTMPCNCACYCGSWSCSYPYSGSGQHGAGSASYAACMSASGVPYGG
CTPNGCVWVGGPGCVAATGGGGGPSTPAPVNCVGSWSGCDASGLKTFTVTTPAANGGTAC
AAAHGATSCSGCTSGTRRCCGNTWSSPAPTTPSIFCGCGNSPEWWPAHLPSGC
Download sequence
Identical sequences M4V4K2
WP_015468752.1.98289 gi|471261014|ref|YP_007643869.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]