SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|471261016|ref|YP_007643871.1| from Bdellovibrio exovorus JSS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471261016|ref|YP_007643871.1|
Domain Number 1 Region: 271-322
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000419
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Weak hits

Sequence:  gi|471261016|ref|YP_007643871.1|
Domain Number - Region: 322-363
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0249
Family TSP-1 type 1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|471261016|ref|YP_007643871.1|
Sequence length 482
Comment hypothetical protein A11Q_44 [Bdellovibrio exovorus JSS]
Sequence
MSRLRLNTKGIGLLQLLLAVGLGSIVSLAFVNALQVSDHEQRKLQLRNELLAIKNHFAST
LHQDQTFLNTIAALENTNMQCLRDRTVCDAGFVGSEYSPLQERLVLYNQSPSPGQIFYDG
RATSSTGFTTKGATCTGFSATGAGNSDCPIGFITTWYLSDVGSYKGVALTLNAKMVFNPA
DDHPLKRFFYAQHVDTVLGSYDIAVTKRVKSLVNNEVLHCEENGVQLNHGAGRVFYQTAG
VPVGSRCQQETRLCTIVNNVPELSGTFNQPSCAQACSGEWSACSAPCGGGTQTFTQIVEA
NEFGPACAHSNGEQRACNTMACGNNCMGDWGACTGGVQRYNVTLPAGIGGDSCPYADGQT
RSCTSEGKWVKTGVANNVHGLGYNSLCHPYKSLLPLCLMQVIYHIDGSQYCESYVLNDLN
GLLNPVLNTLSTCGNFSPDTAVCNPGQSMTMVSAFYVLKGGNLLTNLFDLQNVTTSYSCV
AK
Download sequence
Identical sequences M4VMF4
WP_015468754.1.98289 gi|471261016|ref|YP_007643871.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]