SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|471261020|ref|YP_007643875.1| from Bdellovibrio exovorus JSS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471261020|ref|YP_007643875.1|
Domain Number 1 Region: 376-433
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000353
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 274-326
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000458
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Weak hits

Sequence:  gi|471261020|ref|YP_007643875.1|
Domain Number - Region: 15-106
Classification Level Classification E-value
Superfamily Pili subunits 0.00879
Family Pilin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|471261020|ref|YP_007643875.1|
Sequence length 512
Comment hypothetical protein A11Q_48 [Bdellovibrio exovorus JSS]
Sequence
MRNVTERLSLNSAGFSLIQLMVGVGLATIVSVAVINMMGFSNQEQKRAQFRNDLLKLKNS
FSEVLHQDQSILNTIAATANTNMACLRNRTACAASLVASGYSPTLDRIAIYNSGPNGGQI
FYDGRASSSAGFTEKGTKCTGFSAAGAGNDACPIGYITNWYVNQTSSDQGLTLTITAKLV
FNPSDTHPLKTFVNATGSDTRVGQYDVIVSKRVLSLSNLSVVSCSEGGVTLHHSAGYVFY
ATSSVPLGSRCQQETRVCSVVNNTPSLSGNYTNSTCVQNCSGAWGPCSVACGGGTQTYTV
DVPANQWGAACPHAAGETRTCNTAACAPPAVPVNCVGAWGPCTAGSQTFIVTTPASGGGT
ACTHANGATQSCAATPSTDCVGSWGAWSTCSKPCGSGTQARTFTITTPAANGGAACSATN
GQTESQACNTHACPEVPCFPMTACTGMAHIGDSETCSWGAAYVGQCPFPSHYQSGPIRGS
GGPSGMGTQYWDCYPCGPGSDGSNCYTNPSCH
Download sequence
Identical sequences M4V509
gi|471261020|ref|YP_007643875.1| WP_015468758.1.98289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]