SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291296644|ref|YP_003508042.1| from Meiothermus ruber DSM 1279

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291296644|ref|YP_003508042.1|
Domain Number 1 Region: 282-452
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 1.57e-47
Family MgtE membrane domain-like 0.000000395
Further Details:      
 
Domain Number 2 Region: 139-271
Classification Level Classification E-value
Superfamily CBS-domain pair 1.12e-37
Family CBS-domain pair 0.00000123
Further Details:      
 
Domain Number 3 Region: 10-136
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 7.85e-24
Family MgtE N-terminal domain-like 0.0000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|291296644|ref|YP_003508042.1|
Sequence length 454
Comment magnesium transporter [Meiothermus ruber DSM 1279]
Sequence
MYDAETLVGLEALKNALRESDAFKVKAALEELYPAQILEHWSEFAPEHRLPILTLLSPAE
AAEVFSHLEEAEQAELLEALPPWRVKELLEELSLDDLADAINAVEEENSREAAEALLRQL
DPETRAEVEELVEYDEDEAGGIMTSEYIAVRDSMRVEEVFRFLRREAPDAEQIYVIYVVD
AEEHLQGVLTLRDLIVADPKTRVAEIMNPDVIYVRDDTDQEEVARLMADYNFTVLPVVDE
DKKLVGIVTIDDVVDVIEEEATEDIYRLGAVESPELVYSKSSVFKLWSARVRWLIILIIT
GSITSTILQGFESVLEAVTALAFYVPVLVGTGGNTGNQSSTLIVRALATRDVALGDWLRI
MRKELGVGILLGLTLACLLTIKVLIDGQVQLLWVVGISLGLVVLLANVVGAMLPLLLRRL
KLDPALISNPLIATVTDVTGLVVYLTVARWLLNL
Download sequence
Identical sequences D3PKZ8
gi|291296644|ref|YP_003508042.1| WP_013014520.1.70660 WP_013014520.1.78507 WP_013014520.1.82968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]