SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289579918|ref|YP_003478384.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289579918|ref|YP_003478384.1|
Domain Number 1 Region: 44-115
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 4.19e-20
Family Ribosomal S5 protein, N-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 128-203
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-18
Family Translational machinery components 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|289579918|ref|YP_003478384.1|
Sequence length 221
Comment 30S ribosomal protein S5 [Natrialba magadii ATCC 43099]
Sequence
MSNYNDSGWEPVTRLGRMVQEGEIDTMEAALNSGLPLKEPELVDQLLPGLDDEVLDINMV
QRMTDSGRRVKFRCVVAVGNRDGYVGYAEGRDDQVGSAIQKAIGIAKLNIIKVPRGSGSW
EDRSDRPHSLTRQTTGKAGSVEVEVIPAPEGLGLAASDTVHAVLDLAGIENAWTKSHGNT
RTTVNLAKATFNALENASQSRQPQMRGAADSDSDEAEVADQ
Download sequence
Identical sequences D3SWN0
gi|289579918|ref|YP_003478384.1| WP_004213688.1.6702 WP_004213688.1.81346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]