SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289580208|ref|YP_003478674.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289580208|ref|YP_003478674.1|
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily Vng1086c-like 2.88e-24
Family Vng1086c-like 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289580208|ref|YP_003478674.1|
Sequence length 80
Comment hypothetical protein Nmag_0525 [Natrialba magadii ATCC 43099]
Sequence
MVMKKQELIHLHGLLAEVSNQCAEWDNCEIDLDEYESLGIRPTSIHKSKTDHKAAVFALA
GGITMNMREGEQEAVAATAD
Download sequence
Identical sequences D3SYK1
gi|289580208|ref|YP_003478674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]