SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289580367|ref|YP_003478833.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289580367|ref|YP_003478833.1|
Domain Number 1 Region: 25-81
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000184
Family Carboxypeptidase regulatory domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|289580367|ref|YP_003478833.1|
Sequence length 107
Comment hypothetical protein Nmag_0686 [Natrialba magadii ATCC 43099]
Sequence
MATSRQLTVDLADTEAIIGRPLTIRVRDSSCRPVEGATVRTATGSKTARTNADGYCQLTF
HSPGFWQLFVTRDSDERHTYRPTTTLVRAITAGAATQRTRRAIACRV
Download sequence
Identical sequences D3SZD7
gi|289580367|ref|YP_003478833.1| WP_004216432.1.6702 WP_004216432.1.81346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]