SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289580396|ref|YP_003478862.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289580396|ref|YP_003478862.1|
Domain Number 1 Region: 130-407
Classification Level Classification E-value
Superfamily Subtilisin-like 5.76e-79
Family Subtilases 0.00000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|289580396|ref|YP_003478862.1|
Sequence length 541
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Natrialba magadii ATCC 43099]
Sequence
MTRDTNSNVGRRSVLKAASALGAFLGLGGVASATPGREPGPKKDEIIVGVSERVSSTEAT
VESKIPTNAEIVHTNETLGYVAVKFPSNAAEQARENFKRNVLQEDDIEYAEDNATYETLE
VPNDPMYGQQYAPQQVNCEGAWAETYGDDDVVISVVDQGIQYDHENLAENMDGSVSDYGY
DFVDDDGDPYPVSAGENHGTHVGGIAAGGTNNDTGHAGISNCSMLSARALGDGGGGSLSD
IADAIQWSADQGADIINMSLGGGGFSETLDNACQYAYDEGTLLVAAAGNDHGGSVSYPAA
YDSVMAVSSLDEGETLSSFSNVGPEIELAAPGGNVLSAVNWDDYDSLSGTSMASPVAAGV
AGLALSAHPGLSNDELRDHLHDTAVDIGLSDDEQGYGRVDAELAVTTDPDNGDDDDDDDD
DEDDPGDGECGDETNTATADGELSGGWGGNPSDTYSYELSTDNPCHATVTLDGPSSGATF
DLFLTLDGRTPTTSDYDRRSYNWGADEEIEVDLDGDEELGILVDRYDGSGSYTLTIEELG
S
Download sequence
Identical sequences D3SZG6 Q5RLZ1
WP_004216473.1.6702 WP_004216473.1.81346 gi|289580396|ref|YP_003478862.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]