SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289580545|ref|YP_003479011.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289580545|ref|YP_003479011.1|
Domain Number 1 Region: 72-236
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 6.19e-25
Family N-acetylmuramoyl-L-alanine amidase-like 0.0013
Further Details:      
 
Weak hits

Sequence:  gi|289580545|ref|YP_003479011.1|
Domain Number - Region: 238-300
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.0209
Family Obg GTP-binding protein N-terminal domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289580545|ref|YP_003479011.1|
Sequence length 321
Comment N-acetylmuramyl-L-alanine amidase, negative regulator of AmpC, AmpD [Natrialba magadii ATCC 43099]
Sequence
MCLDCTTHDPDGEQHSSTDDRETTSHSNWKRRSFLQATGVAAGTGTILGTQVDRTAASHT
ECDAADRWVEAANHSARDHSIDWIVIHVTAGAYQGALNTLTSSDSGVSSHYLVKNYDWTD
GPEAGHVDQLVHHDRAAWHARSIANHRSIGIEHEWFDDNGISDACYESSAELVRCIADMH
DIPLEFYTSNTCIQNESGGIIGHTHVPDGDCSSFHHGGRTCPYPDWDMDHFESLVKEEDG
GGGGGGGGDEFQDGDQVVTTTDLNGREQPCLNDDVVLTLPEGTQAEVMNGPEECDDITWW
GLYVPSENEWVWCSENYLAHA
Download sequence
Identical sequences D3T091
gi|289580545|ref|YP_003479011.1| WP_004216638.1.6702 WP_004216638.1.81346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]