SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289580753|ref|YP_003479219.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289580753|ref|YP_003479219.1|
Domain Number 1 Region: 6-150
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000266
Family GHMP Kinase, N-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289580753|ref|YP_003479219.1|
Sequence length 279
Comment GHMP kinase [Natrialba magadii ATCC 43099]
Sequence
MREEATAFVPGHITGFFSAHPADDPTIAGSRGAGLTLTDGVTVTVEPVAEEASESIVILD
GEMIEIEPVDIVLEALDVVARVEAESDLPLGAGFGISGAMALGTALAANAVFGCRLSRNE
LVTIAHGAEVQAGTGLGDVVAQACGGVPIRLEPGGPQENKLDAIPARARVEYVSFGELST
ADVLAGDTDQLTAAGKEALSRVVEEPTLLSFMYASRLFTREAGLLTDQVAKTIGDVTDVN
GQASMAMLGETVFALGTGLSDAGYDPSVCATHPAGALLR
Download sequence
Identical sequences D3SRF2
WP_004216927.1.6702 WP_004216927.1.81346 gi|289580753|ref|YP_003479219.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]