SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289581305|ref|YP_003479771.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289581305|ref|YP_003479771.1|
Domain Number 1 Region: 82-293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-22
Family Laminin G-like module 0.039
Further Details:      
 
Domain Number 2 Region: 4-60
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00000228
Family Cna protein B-type domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289581305|ref|YP_003479771.1|
Sequence length 298
Comment hypothetical protein Nmag_1633 [Natrialba magadii ATCC 43099]
Sequence
MTETISGTVELAGNAQDGVTVYLINESTRTIEDRTETDGSGSYTLETERDGNYIIVPSYH
ESSGDEWHVATPVANALARPRHKGFVGRWPMSEGSGETVADSVNDYDASYAYDEWRSGGI
GGHHIRLTGGFDRVNLPETLTDPIIDLMRDQSFSLGAWFNIDDIDFGSASPIFGFREDDE
QSIYFRVDNDGDLSFRAADNVGGLASTDGLELEEGEWYHIAVVLDSNTIRMYVDAKEVLA
EDYEHDLPDETDGGSLSWGNDADSSTDGYIDDAWISDIPFTHKDIIENYNENKDVHHG
Download sequence
Identical sequences D3SUF1
WP_004217504.1.6702 WP_004217504.1.81346 gi|289581305|ref|YP_003479771.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]