SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289581331|ref|YP_003479797.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289581331|ref|YP_003479797.1|
Domain Number 1 Region: 127-190
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0000000000318
Family Intron-encoded homing endonucleases 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289581331|ref|YP_003479797.1|
Sequence length 203
Comment HNH endonuclease [Natrialba magadii ATCC 43099]
Sequence
MSEYSGRKYPWRDPEVLRELYIGRELSIHDISDTLACSSETVGRWLDEHGIETREPNWEK
TPDELRDESWLREQYIEYNQSAEFLAERLDCAAPTVRTWLDKHGIERRSRTEAVKLSALH
EPARYDVDTEGYARWRVFRDGQRQRVAVHRLLAVSEYGYEEVGQKVVHHKNGIPWDNRPA
NIEVLTAEEHGRIHANGKGGESA
Download sequence
Identical sequences D3SUH7
gi|289581331|ref|YP_003479797.1| WP_004217538.1.6702 WP_004217538.1.81346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]