SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289581397|ref|YP_003479863.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289581397|ref|YP_003479863.1|
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.63e-37
Family YigZ N-terminal domain-like 0.00024
Further Details:      
 
Domain Number 2 Region: 140-202
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000317
Family YigZ C-terminal domain-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289581397|ref|YP_003479863.1|
Sequence length 204
Comment hypothetical protein Nmag_1725 [Natrialba magadii ATCC 43099]
Sequence
MSRTYNTIAEAATAEFVVQGSEFIGHARPVDAVDDAEAFIEAIREEYADATHNVPAYRVR
ADSDGDLLREYSSDDGEPASSAGKPALNVLTQREIENCVVVVTRYYGGTNLGVGGLVRAY
SRAVKDAVDAAGVIEERPHERVSITVEYDDSGTVRGILESEGYEFDAAYEADVSFGVRVP
VADAEALRDRIRSATSGRAVLESA
Download sequence
Identical sequences D3SUP3
WP_004215653.1.6702 WP_004215653.1.81346 gi|289581397|ref|YP_003479863.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]