SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289582127|ref|YP_003480593.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289582127|ref|YP_003480593.1|
Domain Number 1 Region: 134-507
Classification Level Classification E-value
Superfamily Subtilisin-like 8.38e-70
Family Subtilases 0.0000309
Further Details:      
 
Domain Number 2 Region: 1107-1188
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000000000231
Family Carboxypeptidase regulatory domain 0.029
Further Details:      
 
Domain Number 3 Region: 1274-1355
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000000216
Family Rhamnogalacturonase B, RhgB, middle domain 0.013
Further Details:      
 
Domain Number 4 Region: 1192-1264
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0000000000275
Family Cna protein B-type domain 0.0073
Further Details:      
 
Domain Number 5 Region: 514-575
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000824
Family Type I dockerin domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289582127|ref|YP_003480593.1|
Sequence length 1489
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Natrialba magadii ATCC 43099]
Sequence
MEWCHTRCVRGGTNTIKDNYQMTDRREQWTAILFTALMVLSLVAIAGTGLAGSAAAADGI
DTQAVDDETPATIDPELEEATGTEQVYIVLDQYEGDLSDDRDRAIAQLQEHAETSQASVT
ASLDTMANVDVVNDYWITNAVRAEVDASEVDTAELASIEGVQSVELRPDYEVPEPEPSVE
PAVEPDEDDYTYGLDQVNASETWADFNTQGENVKVAVLDTGFDIDHQDLDLYTEDADDPT
YPGGWVEIDEDGDPVEGSEPYDTHYHGTHVGGTVGAAAPADDDTPAYGVAPNVDLQHGLV
LPDGSGADSDTIAGFEYVVEEMDSDVVSMSFGAGCGLFGPVYEDAWIPAIQNANDMDVVT
VTSSGNSGEGCVGSPANTYDSFSIGASNEAGDITDFSSGNTIEAHNWDNPDPEWPDEWIK
PDVSAPGEDVLSAMPDDEYDYLSGTSMSAPHVSGVIALMLSANDDLTQEEIEETLEETAW
KPDGEPDEKDVRYGHGIVDAYAAVDEVAAGALEYELGDVDQDGDVTVQDVQLTQQYLQDM
DPEPFAEDLADMNRDGEVTTDDLSLLQQKVQGMLDEGEIDITGLDVPDEVDDGEMFDVTV
DLENLGEEGAVQEVDLFLGDDDEPVDTEVVDMAAPGVDDPIDHPAETTITFELDAGDLDG
GDHTITVETEDADASDTVTVLASNFELSNLDAPDEADRGDEITVSADVTNTGNVDDTQSV
EYRFDDLGDALDTQNVTLEPDENATVSFDVDTENVTEGTYDHGVFTEDDEATAAIDILEP
FFSVDLTDAPEELAPGDSYSVNATVENTGDASDEQTIAYELGDGGGDVAVVDVAADTSQG
DAVASVLDERLNNDTYDVDMVVADDLLDEMDDYDTFVVQRLGSDTLAEDFLDELESAQSA
VYLDSHQGGSAEAYADGIYRLNNVREDPEERDSEGIGTSSDPVTIDIEQNHPIFTGVGDA
GDEVEMFTGTTTWGSWFDDYSGTTLADADFGDGYAGPSVAVSDDGSELLLTATARDFFTD
EEDFTEEANQLLANSVEFTTTGSVTADAETADSSSVVHLEPGESEDLTFSDVVPEDTEAG
DASHIVASEDEQDFAPVTITGDEANWNVKGTVSDDATDEPIENASVELEADNETYTNVTD
ADGEFGLADVPAGEHDLTVDAEGYASHTDAVHVPENDTATVDVSLEQAAGAISGDVMASD
DDAPVENATIVAENDDGDVHEATTDENGSYELDGVSAGTYVVNVVDTPPGYELDEIVSVA
PGEHVDDVDFVVDRTAGSIEGTVTNAAGVPIADANVIDADDGAFNVTTAEDGSYEIEDVT
PGTNALRAVADGYDDSNVEFVDVETGETTTANLTLGTYFEVDDLAAPDTAEQGEEITVNA
TVTNTGEQEDTRTAFYFPPGTDFGTDVIDYQPELAETVTLEGGESTTVEFTYEIPADDES
GEYEHGISADEVESTTITIEAADDGDASIAHDVTDVAGPNANQLGAAPA
Download sequence
Identical sequences gi|289582127|ref|YP_003480593.1| WP_012996680.1.81346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]