SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289594365|ref|YP_003482372.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|289594365|ref|YP_003482372.1|
Domain Number - Region: 39-66
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.02
Family Intron-encoded homing endonucleases 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289594365|ref|YP_003482372.1|
Sequence length 146
Comment HNH endonuclease [Natrialba magadii ATCC 43099]
Sequence
MTHDDLRALVLDKYGCECIVCGRSPEKWLESEDLDRSQDKISIHHVNGDDSDDRLENLIP
VCQSCHTHIHRVDKPPYRKWHRQLPIEARHAWNQHHAEYYEGDRISREEAERQFGSEGGD
PESLKYKAREGDDAATQTAVKGCQGR
Download sequence
Identical sequences D3T2K1 Q8JKZ9
gi|289594365|ref|YP_003482372.1| Q8JKZ9_9CAUD NP_665975.1.72355 WP_004217560.1.6702 WP_004217560.1.81346 gi|22091161|ref|NP_665975.1| gi|289594365|ref|YP_003482372.1|NC_013925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]