SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|288931395|ref|YP_003435455.1| from Ferroglobus placidus DSM 10642

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288931395|ref|YP_003435455.1|
Domain Number 1 Region: 1-272
Classification Level Classification E-value
Superfamily F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 1.31e-125
Family F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.0000000391
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|288931395|ref|YP_003435455.1|
Sequence length 272
Comment methylenetetrahydromethanopterin dehydrogenase [Ferroglobus placidus DSM 10642]
Sequence
MVKVGILKMGAIGTALLVEYLLDERADREDIEVRVVTSGAKMQPEEAKIAEKLKEFDPDL
VLVVSPNAALPGPKAAREAFEGKPVIVISDAPAKKAKEEFEQKGFGYILVNADSMIGARR
EFLDPTEMALFNADVVKVLAATGAFRIVQEEIDKVIEALKKGEKPELPKVVITAERAVEA
AKFSNPYAKAKAMAAYFIAEKVADVDVRGCFIEKDPEKYIPLVAAAHEMMRIAAKLADEA
REIEKSNDTVFRNPHARDGKILSKTKLMEKPQ
Download sequence
Identical sequences D3RXG7
WP_012965523.1.13673 gi|288931395|ref|YP_003435455.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]