SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|288931735|ref|YP_003435795.1| from Ferroglobus placidus DSM 10642

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288931735|ref|YP_003435795.1|
Domain Number 1 Region: 3-241
Classification Level Classification E-value
Superfamily Aquaporin-like 6.93e-62
Family Aquaporin-like 0.0000544
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|288931735|ref|YP_003435795.1|
Sequence length 244
Comment MIP family channel protein [Ferroglobus placidus DSM 10642]
Sequence
MSLAKRFVAEVIGTALLVFFGAGSAAITLMLAKNAQKPNEFNIGIGALGGLGDWLAIGMA
FAIVIMAVIYSLGRVSGAHINPAVTIALWATKRFPTSEVIPYIAAQLIGAALGSTLFLAC
VGSDAALVGGMGATAPFPGISYSQALLAEMVGTFVLMLVIMGVAVDERAPPGFAGLVIGL
TVGGIITTIGNISGSSLNPARTFGPYLVDSAFGIDLWKFFPIYVIGPIVGAVVAALLYDF
LSSE
Download sequence
Identical sequences D3RYF7
gi|288931735|ref|YP_003435795.1| WP_012965863.1.13673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]