SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|288932280|ref|YP_003436340.1| from Ferroglobus placidus DSM 10642

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|288932280|ref|YP_003436340.1|
Domain Number - Region: 119-255
Classification Level Classification E-value
Superfamily Aquaporin-like 0.0915
Family Aquaporin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|288932280|ref|YP_003436340.1|
Sequence length 318
Comment glycosyl transferase, family 4, conserved region [Ferroglobus placidus DSM 10642]
Sequence
MEFLGTLIAAFGLAMLLIPLQIKKFKDRNRVVKDYYKNSAQYVPTSGGLSILLAFYAVVF
LAMFGSFPFQISLPEAVSLFIISLYGLFGLIDDFVDIGRATKIVFPPLFTAPIAFVAATA
WIPVVGEVSGYFLFIAAPIYVMVVANLVNMHSGFNGMAAGLTAILLAFLLVKTLITGRGS
VLITSSMLGAVLGFLYYNWYPSKIFDGNVGAFAMGSTVGLSIILGGFYVSGFVMLFPHTL
NFLLYVYWRIMRKMKPQDRRYEIVKFGRVRRDKTIEAPNPYTLKWVLPYYFKMTEKQVVL
SMYGLTTIFCIIGLFIPY
Download sequence
Identical sequences D3S002
WP_012966404.1.13673 gi|288932280|ref|YP_003436340.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]