SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|288932425|ref|YP_003436485.1| from Ferroglobus placidus DSM 10642

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288932425|ref|YP_003436485.1|
Domain Number 1 Region: 471-672
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.57e-27
Family Terpene synthases 0.0086
Further Details:      
 
Domain Number 2 Region: 398-461
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.0000000000471
Family Terpene synthases 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|288932425|ref|YP_003436485.1|
Sequence length 756
Comment prenyltransferase/squalene oxidase [Ferroglobus placidus DSM 10642]
Sequence
MKKGAILLLVSALLLIQTSNGLTIDVSGNCVGEKLKITVDKPSFIVIRINNGTPIYANGT
TAYFTPQLTGKLYIEAISGSEKASKLVDVVSCQTKGGSEPMGDYTLPSGTTTISADGESV
SIKYRTALGALIRAAEVKGFSVKVKKWSYGLFVDCIKGVCTGDLGATSGWMYAVDGVIPS
VSSEQYELNAGDKVVWYFSRSMSETPESSPYRIEIITFPDWTFSVNVYWKTPSYEEAEAP
ASTPSPTPTPAPEKKERVIELNLTKRAEVVKPNETLAIDLKIPMRLKIEGEKPVLIELAQ
RKVGGVEFRNVHGDVLEAFELKVNESAKILLNFSVKKELLENKSPENLCLAKYVEYEWKC
LKTNLIDENETHYFFSSKITNFSLFAIIVKWDNFPLKPEDERIVKALNWLKSVQNDDGGF
SNPGEESSVAKTSWAIMALVAAGEDPEKWKKNGKSPIDYLRENLEDELPKMGTADYARTI
LALVAAGEDPRSFAGVNLVEKLKERVKENGQIGDYIYTTIWGILALVSVGEDVNKSVDWL
KEQQNGDGGFAWAVGEKSDFDDTAAAIQALIAAGESKDSEVIKKALSYLKQGQNEDGGMR
YFGNSASNAASDSWTIQALVAAGINPVEWKKNNISVVDHLLSLQTEESYFKYTSHQTSNP
GYMTVSAIMALLGKPHPIKVMEKEEVSAPTPTPAKVLETPKPEKTSEKIVEETPTQTPAP
EIKETPIPKPTEEKKGIPGFEAVIALLVLAARAVRK
Download sequence
Identical sequences D3S0E7
WP_012966549.1.13673 gi|288932425|ref|YP_003436485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]