SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269795632|ref|YP_003315087.1| from Sanguibacter keddieii DSM 10542

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269795632|ref|YP_003315087.1|
Domain Number 1 Region: 8-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.44e-44
Family Ribonuclease PH domain 1-like 0.000000409
Further Details:      
 
Domain Number 2 Region: 322-493
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-43
Family Ribonuclease PH domain 1-like 0.000000948
Further Details:      
 
Domain Number 3 Region: 153-261
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.32e-24
Family Ribonuclease PH domain 2-like 0.0000105
Further Details:      
 
Domain Number 4 Region: 475-574
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.75e-22
Family Ribonuclease PH domain 2-like 0.0000161
Further Details:      
 
Domain Number 5 Region: 577-689
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.11e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 266-346
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.33e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269795632|ref|YP_003315087.1|
Sequence length 735
Comment guanosine pentaphosphate synthetase I/polynucleotide phosphorylase [Sanguibacter keddieii DSM 10542]
Sequence
MEGPEIEFEEAVIDNGRFGTRTVRFETGRLARQAAGSAAAYLDGETMLLSATTVGKHPKD
QFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTEAILTCRLIDRPLRPTFVKGLRNEVQ
VVVTVLAAHPDDAYDTLAINVASLSTQLSGLPFSGPVGAVRIALVDGQWVAFPKYSDKEK
AVFDMVVAGRVAGDDVAIMMVEAEATDNSWTLIKDEGVAAPTEEVVAEGLEASKVFIRQL
CEAQAALAARAAKPVREFPLFLDYQDDAYAAIEAQVATPLGQALTIADKQDRENRLDEIK
AEALEALAGQFEGREKELSAAVRSVTKKLIRQRVLTDGVRIDGRGLADIRTLSAEVEVVP
RVHGSAIFERGETQIMGITTLNMLRMEQQIDSLGPETRKRYMHNYNFPPYSTGETGRVGS
PKRREIGHGALAERALVPVLPTREEFPYAIRQVSEALSSNGSTSMGSVCASTLSLLNAGV
PLRAPVAGIAMGLISDTVDGKPRYAALTDILGAEDAFGDMDFKVAGTREFVTAIQLDTKL
DGIPASVLGGALTQARDARFAILDVLGEAIDVPDEMSPHAPRVIAVKVPVDKIGEVIGPK
GKMINQIQEETGADISIEDDGTVYIGATDGPSAEAARAAINAIANPHVPEVGERFVGTVV
KIAPFGAFISLSPGKDGLLHISQIRKLVGGKRVENVEDVLSIGQKVQVEIGEVDPRGKLS
LHAVVDEAEAGQADT
Download sequence
Identical sequences D1BJ59
WP_012867322.1.42826 gi|269795632|ref|YP_003315087.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]