SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357410011|ref|YP_004921747.1| from Streptomyces flavogriseus ATCC 33331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357410011|ref|YP_004921747.1|
Domain Number 1 Region: 52-421
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 3.66e-63
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000364
Further Details:      
 
Domain Number 2 Region: 419-744
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 2.62e-41
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357410011|ref|YP_004921747.1|
Sequence length 746
Comment cellulase [Streptomyces flavogriseus ATCC 33331]
Sequence
MRASSVPQPEPASHPRRRSVLAGAAAVAASGSVLPAAVGAAAAPRPGRSEPYRWRTAAIG
GTGFVTGLLFHPAVRGLAYARTDIGGAYRWDDRRSRWTALTDHIGWDDWNLLGVEAMAVD
PAHPDRLYLALGTYAQEWASPGAVLRSDDRGATWARTDLTVRLGANEDGRGCGERLLVDP
LDSETLWLGTRHDGLLRSRDRGATWSADTSFPATPSAGGQGVTLLVAAGRTVYAGWGDGG
GAALYRRTASGGWEAVPGQPSDGGATRVPVRAAHDAGGRALYVTYADGPGPNNQSDGSVH
RLDTATGGWTDVTPVAPGDGDAFGYGGVAVDAARPSTVVVSTNNRWGPVDTLFRSTDGGA
SWTSLKDTAVLDVSETPYLKWGGEPKFGWWIQAVALDPYDSRHVLYGTGATVFGTRDLVH
WAPEVRGLEESAVRQLIAPPSGARLLSGLGDIGVMRHDSLTSSPSRGMASNPVFGTATGL
ALATLKPSYVVRTGWPSGSDRAGAYSRDGGASWQPFASQPAIAPSAPGPVAVSADGATLL
WSFVHWDGTTYAAHRSTDGGASWAEVTTFPEGAAPVADPLDPRRFYAYDTGTGTVLLSTD
RGATFTEGAKGLPSGDAQFRIAAAPGRSGDLWLSAKDAGLLRSTDGGVTFTRVAGCQASH
ALGFGKAAPRKGRAGYPAVFQTGRVSATYDGVAVLRSDDAGATWVRINDDAHRWGWTGEV
ITGDPRVHGRVYLGTNGRGIQYADPQ
Download sequence
Identical sequences E8WBI7
gi|357410011|ref|YP_004921747.1| WP_014152905.1.77427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]