SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357412621|ref|YP_004924357.1| from Streptomyces flavogriseus ATCC 33331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357412621|ref|YP_004924357.1|
Domain Number 1 Region: 12-224
Classification Level Classification E-value
Superfamily HAD-like 3.06e-31
Family Phosphoserine phosphatase 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357412621|ref|YP_004924357.1|
Sequence length 279
Comment HAD-superfamily hydrolase [Streptomyces flavogriseus ATCC 33331]
Sequence
MLTFVENCFSPRTAAFFDLDKTVIAKSSTLTFSKSFYQGGLINRRAVLRTAYTQFVFLAG
GADHDQMERMREYLSALCKGWNVQQVKDLVAETLHDLIDPIIYDEAATLIEEHHTAGRDV
VIVSTSGAEVVEPVGELLGADRVVATRMVVGDDGCYTGEIEYYAYGPTKAEAIKALAESE
GYDLSRCYAYSDSATDVPMLESVGHPHAVNPDRTLRREAALREWPILVFDRPVRLKQRLP
AFSMPPRPALVAAAALGAAAVTAGLVWYTNRRRASTLAT
Download sequence
Identical sequences A0A285DAS0 E8WF68 M9TZ75
gi|357412621|ref|YP_004924357.1| gi|479320217|ref|YP_007860268.1| WP_014155461.1.77427 WP_014155461.1.77540 WP_014155461.1.81163 WP_014155461.1.83303 WP_014155461.1.8887 WP_014155461.1.8937 WP_014155461.1.98132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]