SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357413442|ref|YP_004925178.1| from Streptomyces flavogriseus ATCC 33331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357413442|ref|YP_004925178.1|
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.62e-25
Family N-terminal domain of MutM-like DNA repair proteins 0.0044
Further Details:      
 
Domain Number 2 Region: 121-205
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.27e-23
Family Middle domain of MutM-like DNA repair proteins 0.0039
Further Details:      
 
Domain Number 3 Region: 219-268
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000114
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357413442|ref|YP_004925178.1|
Sequence length 273
Comment DNA glycosylase/AP lyase [Streptomyces flavogriseus ATCC 33331]
Sequence
MPEGHTIHRLAADHHERFAGRPVRVSSPQGKFSDSAALLDGRVLTGVDAHGKHLFLGFEG
SAWVHIHLGLFGKLGFGTVPAPPPTDTVRLRLLNDSHHADLRGPTTCALITGPEKRAIHD
RLGPDPLRADEDGERAWLRIARSRVTVAALLMDQKVVAGVGNVYRAEVLFRHGIDPYRAG
KDLTRAEWDAIWADLGVLMREGVRNNRIDTVRPEHLPEAMGRPPRVDDHGGEVYVYRRAR
QACHICGTEIRTADLAARNLFWCPACQPSAAGR
Download sequence
Identical sequences E8WA38
gi|357413442|ref|YP_004925178.1| WP_014156275.1.77427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]