SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357414016|ref|YP_004925752.1| from Streptomyces flavogriseus ATCC 33331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357414016|ref|YP_004925752.1|
Domain Number 1 Region: 25-277
Classification Level Classification E-value
Superfamily Cgl1923-like 1.44e-71
Family Cgl1923-like 0.00000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357414016|ref|YP_004925752.1|
Sequence length 312
Comment hypothetical protein Sfla_4834 [Streptomyces flavogriseus ATCC 33331]
Sequence
MPDPQSLYEWEPKGLAVVDMALAQESAGLVMLYHFDGYIDAGETGEQIVDGLLETLPHQT
VVRFDHDRLVDYRARRPLLTFKRDRYTSFESPALEVKVVQDATGAPFLLLSGPEPDVEWE
RFAAAVEQVVERLGVRLAVSFHGIPMGVPHTRPVGLTPHGNRTDLMPGHRSPFDEAQVPG
SAEALVEYRLMEAGHDVLGVAAHVPHYVARSSYPDAALTALEAVTAATGLVLPSVAHTLR
TEAHRTQTEIDRQVGQGDEELVSLVEGLEHQYDALAGAETRGNLVAEPADLPSADEIGRE
FERFLAEREGDS
Download sequence
Identical sequences A0A285D2A4 E8W0M0 M9TV32
gi|479318767|ref|YP_007858818.1| gi|357414016|ref|YP_004925752.1| WP_014156845.1.34797 WP_014156845.1.77427 WP_014156845.1.77540 WP_014156845.1.81163 WP_014156845.1.83303 WP_014156845.1.8887 WP_014156845.1.8937 WP_014156845.1.98132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]