SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357414351|ref|YP_004926087.1| from Streptomyces flavogriseus ATCC 33331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357414351|ref|YP_004926087.1|
Domain Number 1 Region: 2-260
Classification Level Classification E-value
Superfamily Cgl1923-like 2.75e-88
Family Cgl1923-like 0.0000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|357414351|ref|YP_004926087.1|
Sequence length 345
Comment hypothetical protein Sfla_5171 [Streptomyces flavogriseus ATCC 33331]
Sequence
MIELEGVPELIDPVMVAAFEGWNDAGDAASTAVAHLDREWKGEVFAALDAEDYYDFQVNR
PTVWMDGGTRKITWPTTRLSVVRVGGEKPRDLVLIRGIEPSMRWRSYCNEILGFAHELGV
EMVVVLGALLGDTPHTRPVPVSGVTSDPDLARTMDLEETRYEGPTGIVGILQEACTHAGV
PAVSLWAAVPHYVSQPPNPKATLALLNRLEDLLGLRIPLGELPEDARAWQLGVDQLAAED
SEVAEYVQTLEEARDTAELPEASGEAIAREFERYLRRRDVGGPGQAPGGHATESGDMPYL
RDTSGGRTRPPKPQRPEKGRPKDGDGGDPPEDPPATGPDGSASDD
Download sequence
Identical sequences A0A285DHV0 E8W6V5 M9TLI2
gi|479318396|ref|YP_007858447.1| WP_014157179.1.77427 WP_014157179.1.77540 WP_014157179.1.81163 WP_014157179.1.83303 WP_014157179.1.8887 WP_014157179.1.8937 WP_014157179.1.98132 gi|357414351|ref|YP_004926087.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]