SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357413405|ref|YP_004925141.1| from Streptomyces flavogriseus ATCC 33331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357413405|ref|YP_004925141.1|
Domain Number 1 Region: 184-458
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.25e-40
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Domain Number 2 Region: 664-771
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000127
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357413405|ref|YP_004925141.1|
Sequence length 910
Comment serine/threonine protein kinase [Streptomyces flavogriseus ATCC 33331]
Sequence
MSTECQRPTCGGAYEDMGGGELYCDTCGLAPVVSPTGLVSSPPTGIAAGGRGGDSASQRT
GSRASARSSSRSSTSRRSVSGRLSRSLSGSPTSRSVSVRSSGTSTGSASGRGRLGAGLVL
VPDVPRPDPRTAVMENPEVPERKRFCSRSDCGAPVGRARGERPGRTEGFCTKCGHPYSFV
PKLRGGDVVHGQYEVAGCLAHGGLGWVYLAVDRAVSDRWVVLKGLLDTGDQDAMAAAISE
RRFLAEIEHSNIVRIYNFVEHLDARTGSLDGYIVMEYVGGKSLKEIANELRTPAGRRDPL
PVEQACAYGIEALEALGHLHSRNLLYCDFKVDNAIQTEDQLKLIDMGAVRRMDDDESAIY
GTVGYQAPEVAEAGPSVASDLYTVARTLAVLTFDFQGYTNVFADSLPDPDNIEVFRRYES
FYRLLVRATDPDPARRFSSAAEMAEQLTGVLREVIALQTGRPRPALSTLFGVEMRVTDTE
LFAELTEEVSRLGVREDPPGRRGRFGRRGAAAVPAAALPAPAPTGTPAPPVAVPQAVGAA
PLHAPDTHVRGSAGGGYPGGAVAQVPHRASVPAPRPAVPAAVAPPSVLAGAGPRLAAFDA
RGTSLALPVPRVDPNDPNAGFLAGVMASAPAELISALHSVPAASLETRLRELRARLELRE
PDSAVRALTAVEAQHPDDWRVVWYRGVTSLVTGDNENAALSFDAVYDAFPGEPAPKLALG
VCAEVLGQLDNAAEYYHLVWATDPSFVSSAFGLARVQIAAGDRAAAVRTLESVPESSIHY
TAARVAAVRARLRGRAPQEPLIDDLSAAADQVTALKGYGLDAVRRERLSTEVLGTALDWV
LSGSPTAQPAAPSSPAAAGPGTVLGSELDERGLRSGLERSYRMLARLAQRGDERIELVER
ANRLRPRTWV
Download sequence
Identical sequences E8WA01
gi|357413405|ref|YP_004925141.1| WP_014156238.1.77427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]