SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357415397|ref|YP_004927133.1| from Streptomyces flavogriseus ATCC 33331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357415397|ref|YP_004927133.1|
Domain Number 1 Region: 7-165
Classification Level Classification E-value
Superfamily Serpins 0.000000000000249
Family Serpins 0.0055
Further Details:      
 
Domain Number 2 Region: 279-385
Classification Level Classification E-value
Superfamily Serpins 0.0000000589
Family Serpins 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357415397|ref|YP_004927133.1|
Sequence length 394
Comment proteinase inhibitor I4 serpin [Streptomyces flavogriseus ATCC 33331]
Sequence
MASHGTVKAVNDLAMRWTAVLPHAGTVLAAAGVWPLLGLLAHGAAGAARRELSDALSIPA
DGAATAARDLLATLRATHGLGAALGLWSRSTLPVEPAWLDQLPAEAHGHLTGDPVRDQVH
LDTWAANRTQGQIDTMPITVNDETLLVLASALTLRTDWIRSFTPGGMEAGTGPWRDMNLA
GLHRTTRLLNRVGVVDTEAGPLTELQIIGTHGIDVHLYLGTPEASAGQVLTAAVGALHNR
RAMVPGDHLPHGTPGPGLSVTRVLSVDGESVLRVSTVPFTVTSHHDLLNHHDLFGLGTAT
DTSQGHFPGISAKPLAVQAAAQAMTATFGARGFRSAAATAFTTVVGGVPRFPFRAREITV
RFDRPFGFLALHRTSRLVLNAGWVAVPDTLEEAA
Download sequence
Identical sequences E8W4L5
gi|357415397|ref|YP_004927133.1| WP_014158218.1.77427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]