SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302872938|ref|YP_003841571.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302872938|ref|YP_003841571.1|
Domain Number 1 Region: 505-671
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.89e-47
Family Histidine kinase 0.00039
Further Details:      
 
Domain Number 2 Region: 701-827
Classification Level Classification E-value
Superfamily CheY-like 3.84e-37
Family CheY-related 0.0021
Further Details:      
 
Domain Number 3 Region: 437-515
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.94e-19
Family Homodimeric domain of signal transducing histidine kinase 0.00072
Further Details:      
 
Domain Number 4 Region: 893-1028
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000000144
Family Histidine kinase 0.031
Further Details:      
 
Domain Number 5 Region: 52-198
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000187
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302872938|ref|YP_003841571.1|
Sequence length 1028
Comment signal transduction histidine kinase LytS [Clostridium cellulovorans 743B]
Sequence
MHKNEKQWYRYAFIILSVTIFLLLVYRLTTSAEIRHGINAVNGQIDLSNVELDKNNYVDL
DGEWEFYWKKQLSYLQQDQFKQKPDAVLKLPSVWRRNIVNGERLTSFGYATYRLKVKVKN
KDQLLTLKLPAIHTSYSVYINDKLIGSGGIAGQDKATSKADLKTVISTFAPPGEEFYIII
HVSNFSGSLSGIWDSIQLGNQESINSLWSDYIKKDLFLFGSSLIMAIYHLSIFFMRGKKK
PSLYFAILCIIVNIRISVLDSYFIYKIIPSASYGLVNFLNFFTIFWGPVIYAFFIFELFP
FKKAKVIKNAISYIAILETLIALIMPVHVYTVGTIVYDAIDVVTLGICTFISIRAVFKKQ
EGAVIILTSSIIVVFSMIYDTVFELKLVGGHTEVTPIAFFIFIFLQAFTLARNFSKDYND
VIVMTTQLEDMLNKEKTLTEKLTKLDKLKDEFLANTSHELRTPLNGIINMTEAVLSGAEG
YVNDMQRRNLSLVVSSGKRLNNLVNDILDMSRLKYKDIRLNRKTYDAKKLIFSVVNIFEY
IKPNKQVRIELSIEEKLPFILVDEDRFNQILFNIIGNAMKFTHKGKIAVSTERIDNFVEI
RIEDTGIGISEDKLDQIWNAFEQIDASITRKYGGMGLGLSITKNLVELHGGSINVESQIN
KGTIFRFTVPISEEEIEENSSKSNLEDKKYNYALSVPERIHGDSGKILVVDDEIINLHSI
ANILKHENYDITCVADGESAIEILKRDKSFSLVILDIMMPDMTGYQVCKAIRETDNLFEM
PILMLTASNQPKTVIQAFKEGANDFLYKPFEVDELLARTKTLTELKKSVIKAFDMEMAFL
QAQIKPHFLFNVINTIVALCDDNPEEASELLIEFSSYLRSSFDFRNLEQAIALEKEIEYV
NSYLKLEKARFGEKLTIEFDIDDSIKAKIPPLVIQPLVENAVKHGVMKKSEGGTVRLSIK
ETNGEINVSVKDDGVGISKDILQGILKNDSKRRSVGVKNIDKRLKRISGRGLQINSNEGE
GTEIQFSI
Download sequence
Identical sequences D9SMM2
gi|302872938|ref|YP_003841571.1| WP_010073084.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]