SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302872942|ref|YP_003841575.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302872942|ref|YP_003841575.1|
Domain Number 1 Region: 879-969,1858-1963
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000627
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 2 Region: 2211-2233,2261-2324
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000114
Family Carboxypeptidase regulatory domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302872942|ref|YP_003841575.1|
Sequence length 2372
Comment fibronectin type III domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MVLFKSKNNRCKRIVAILLIFTMLNSIIYGWNFGMLEVHAVGLVNGGNNGVITFGTLSTL
ELKSSTSVAGGQINVIDNLGSGFDIYSENGSSTKLMIRNMTGAGSFTTYNATPPAAFVQV
IGTAQNASNPTPIQYVDFRANTGIFDLDSLKVTSGDNNFSSYNFNVEPLDSSYMPTGQIK
TVSNVATYVFSTLDLSGDSNFDGIYGFRITVSQGCQICVDDIAVTNPRMPVPPNISPTLN
PFMPILPAITEDDTANNGQIINSFIGTSINDADTGAQKGIAIISMDNQNGAWEYSSDGVS
WNPISSVNLTNALLLREEDKVRFVPDGKNGTILPAKLTYKAWDQTVGTTGTRFDASTSGG
SSAFSINFDIVTVNVASINDAPVITPPGNNFTQISEVDTNNVGNTVADIIGTSITDVDTS
ATKGIAIIHATNGNGSWQYSTDNGSNWFDVGVVDDESNSLLLGNTDKVRFVPNGIKGTTA
SIFYRAWDKTSGNAGDKVSTISNGGTSAFSFDFSKSNITVSDVNYAPTLTSVATLNGLDK
TNTITYADLVAAADEADSDGDTVSFRIEGVNTGNLLKNGLPVATGVTTIGPGESLSWTVA
NNTSGLINAFTVKVFDGTATSSTAVQVKVNVQDTTPPVIPGANCPNDGTYLVGNTLNFGV
FSNEVLFVTEGATGKPYLEILLGKGTANARTVRAEYVSGSGTNTLNFAYTIVSGDSSGQY
ETELNPMIQLNNCTIMDTSGNNVVSSFSNYDLSRVIVDTFAPVWRTGYPKVDTITSNSIK
VVMQSIDETGTAYYVCLPNNSGEPSVAQVKAGQDATGSPLVSSLSGSSPVNITSDTFFTV
SSLAVAADYDIYVVVEDAFGNIVTTNKRIDAKTKTIPIADFSISSKTANTASLTWTSAIG
TSGIVVEQALVGTVNWIPAVTGPLALNASTAKVIGLAANTAYKFRLIVTGGVNEGISNVV
TVSTDELPLVISVAGPSNSTYKVGDILDFKVTYDKNVTILGGTPSLKLAIGSNAREATYK
SGSGSSVLSFRYTIQAGDLDTNGITFASSNISLNGATIRSTANEDANLSLNGVVNLSGVL
VDGVSPMVTSLSLPINTTYKTADAIYVTANFDESVFILPGPTGVPYIELTIGTKKVKAQY
YSGSGSQTIKFAYTVASGEVDSDGIDIATIINPNTGSIKDNIGNEAVYAYTNVNSSGLFV
DAVAPTLTNSVISSDKKTIILSFSKNLVSAVADFGSVVNLSTDGGLIYKPVSSLANINGL
DINGKDIVITFDTPLTGSKNKVAIGANSIKDVLGNLQTNVIETGNLGLAKPIAVKVPTVG
VYKAGSQLNFTVVFDENVIVDTSLGTPTLQLTVGSTSREAVYFSGNGSNEITFAYTVEAG
DNDNDGIKIASTAIELNGGTIKNSSNDNADLILNNIQDSSVVKIDTKSPTITSLTLPLNK
TYKVGEAIQIIVNFDELILQMAPTTITIKVGDKSIAVPCITPPPGPVNAMVFIYNVTAGD
IDEDGISLGNIIYYIGTVKDMAGNDAILSYSSVDTSGILVDAVAPKFVGVELNPDKKIVT
LSFDEDIVDVTGSLLEDSVYLSTNGGTTYSQFSSLANKGSISINGKDLIVDFITPLDGSK
NKIKVVENSIKDVFQNIKTDVTETSNLGTTISIAMDEPFTEQNLNGRVLTINIDGETFKD
ASLDKANFIINNAPKGVTVKAVTYTDSTHGLITLSYDGSDMDSFITNVGVTVLGSELTKG
KDIKTNGIVIKVMDDPEAISIKNLSPIKEREEDKQVITVNITGGQFNDGLNKDNWTVTNL
PAGVTVGSVTKVNANTAEIVLVGNSTDDYDSDINNVTVSCGTSEYNDSTGGSSLIADTGV
TFTAKTIGVVTTNSIASIGKTSATLSGDVISSGDGTIKEKGFIYRISTEATGAKKVVSNE
NTLGQFIASLTGLKANTTYYVKAYVENEEGISYGSEMSFTTMPYSTNAKLKNLESSSGTL
TPKFDTDTKNYTAVVDYTVDSIIITPTLAEEKVVMPSTMSFASILKDTNIATATIKVNGV
LVNSGQPSQSISLKEGDNTITTIVTAEDGVTTETYTLVVTKKPAPTVVKGKVVDSDGKVV
DTIEVKVTTELDGTLTAGLKAKEILFINTASGNNSVLEDLLKLSIDTNSDSKGSILQDGT
VKFSSLEKGKNYEYKVICSIGKFKMELGIIRIKVDNNGNVELTSTLIDPYGVITDAKSGK
VIDGVNVVVFYADTQRNKDAGIVPNTEVSLPIISGFAPNDNKNPQISDSFGSYAFMVYPN
TDYYIVATKDGYEKYTSPIISVEKEIVKWDFKMNPLENNTTFVTNPDTSMPATGSAIDKK
VLVEVGIVLILVGIVSVFTSVRISRKKKSNNK
Download sequence
Identical sequences D9SMM6
gi|302872942|ref|YP_003841575.1| WP_010073080.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]