SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302872943|ref|YP_003841576.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302872943|ref|YP_003841576.1|
Domain Number 1 Region: 566-593,803-928
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000258
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 2 Region: 1815-1837,1865-1919
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000471
Family Carboxypeptidase regulatory domain 0.031
Further Details:      
 
Weak hits

Sequence:  gi|302872943|ref|YP_003841576.1|
Domain Number - Region: 1501-1589
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00126
Family Fibronectin type III 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302872943|ref|YP_003841576.1|
Sequence length 1975
Comment hypothetical protein Clocel_0022 [Clostridium cellulovorans 743B]
Sequence
MRRRKRKRILAEFLALTLLINMFFTGVTQEIAYAASGTITFNTTDGTSMGSLLLDGQWNS
TDISGIDLKFFNANNASDATNEVLAGGFIYSVDYSGIVAMDASTGTQYQYTVIKAGNGSK
FSLNAIYLNDWVGGMGATIECYDGNMFLGSDNINADGGILFHTSSVSNPSKYQAITEIRI
SNSSDVTYGNPVAINNISIGDPIIPNAAPILNPISPTMPNITEDSTISGGQVISSFIGTS
ITDSDVGAKKGIAIISTDNQNGAWQYSVDGIFWNGISSVSNTSALLLRVEDKVRFVPNGK
NGSSSPAKITYKAWDQTYGTDGSRADCSLSGGSSAFSVNSDTVSLNITNVNDAPVLTTGH
NFTSISESDINNPGNSVADIAGTSITDVDINSAKGIAINSSNNGNGVWQYSIDGGSNWTN
IDVVNSANSLLLRDIDRVRFVPNGMKGTTASITYRAWDTTTGTYGIKQSSAAYGGSTAFS
SATNSASISVSNINYPPTLTSVNDLNGVDKTNTITYADLSAAADEVDSDGDTISFRIEAL
NTGTLRKNGNLSVTAGVTTIGPGESLSWTVPNNTNGLLNAFTIKAYDGTVASNTAVQVKV
NVQDTTKPVINLVDRPSDGAYVVGNTLVFSIHSTENLYLTQNGVGVPYLDVKLGVNIVRA
YYVSGAGTSTLTFVYNVVDGDYSGLNETIITPKVQVNDYFIKDIAGNNLVVDFAACDLSQ
VKVDTLAPTWAASYPKTNIITSSSIEVAMKTADELGTAYYVCLPSGSMEPTLAQVVAGQD
AVGNLLQSNLKGYTAINKISDTFFNVDSLAPVTDYDIYIVAVDSLGNAKKTVTSAKTKSI
PITDLSPSSKTANTVTLTWTSAIGASGIIIEQSLVSLEDWVPATTGPLALSADTAKIIGL
VANTDYKFRVVVIGGVNEGISNAVTVATDELPLVTSVTGPSNGTYKEGDILNFIVTYDKN
VTILGGTPSLNLIIGSNTREATYKSGSGSGVLSFSYTIQAGDLDTDGITLASNNISLNSS
VIRNNYDEDASLVLNGVANFSGVLIDGVAPTVTTVSLPASTTYKAGDQIYVIANFDKCVF
IMPGSSGIPYIELTVGAKKIRAYYYSGSGSQNIKFACTVASGNFDGDGIDIGTTIASNTG
VIKDYAGNEAVYTYSSVDSSGLLVDAVAPIFKGAVISTDKKSITLTFDEDITSKVADLGS
QISLSSDGGANWIMFNSLANKDAMTISEKDLILTFNSPLIGSKNKISILQNTIKDLFENI
KTSNTETGNLGSSIEAKEDAALVEDKLDGRVINLAITGDNFKNNDLDKTNFILNNVPKGV
TIKTVGYIDSTHCLVILSYDGSDFDADINNLSITVDTSELVGSPSIVTNNMIVTAINDDE
KISIKNSSTIKEGAEDQTIITVTLTGGQFADTLNESNWTVSNLPLGVNKGVVTRVDSHTV
EITLVGNTTEDYDNDITNVSVTCTSSEYTDSTSGNSLVANTGVVLSAKTAAIVITNPVTE
LGKTSVRLNGNITSSGNAIIKEKGFLYIEQKDPVEVKKVVSTEDSIGEYSTTLSNLIPNT
VYEARAYVENEEGIWYGDVISFTTMPYSTNAKLKNIETNSGTLSPIFNSETKAYTAIVEY
DVDNITVVPTVEDTGLAAIKVNDISVDSGKPSQDISLKTDKNTITILVTAEDGITTDTYT
LDVYKKLQPILVEGKIIDKDGNNVDKAKVTVRPELDGTYTVEVKSNEALLIKTASGTKTT
IKDYSKLKFISTSGPEGSISGDGNIKFSSLEKGKTYEYNAICKVGNSEIVIGKIKVQISD
SGNVEVISDLIDPYGTITDATSGKVIDGVSVVLFYSDTARNRVAGIEPNTEVLLPIIDGF
APNDNKNPQISDSFGSYAFMVYPNTDYYIVATKDGYEKYISPTISIEKEIKKWDFKMNPI
VPSKPTKPSTPVSTDKETVIPATGSPIDTKVLVIVGIVFVVAGFAISKKKKSNKK
Download sequence
Identical sequences D9SMM7
gi|302872943|ref|YP_003841576.1| WP_010073078.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]