SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302872951|ref|YP_003841584.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302872951|ref|YP_003841584.1|
Domain Number 1 Region: 12-359
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.79e-78
Family NagZ-like 0.0000527
Further Details:      
 
Domain Number 2 Region: 360-427,564-711
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 2.88e-53
Family Beta-D-glucan exohydrolase, C-terminal domain 0.001
Further Details:      
 
Domain Number 3 Region: 835-952
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.21e-24
Family Family 6 carbohydrate binding module, CBM6 0.001
Further Details:      
 
Weak hits

Sequence:  gi|302872951|ref|YP_003841584.1|
Domain Number - Region: 442-502
Classification Level Classification E-value
Superfamily Actin-crosslinking proteins 0.0471
Family Fascin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302872951|ref|YP_003841584.1|
Sequence length 965
Comment Beta-glucosidase [Clostridium cellulovorans 743B]
Sequence
MTTERMENNKILYPFRNPNINIEERLDDLISRLTLEEKIHVLPGYQAPIERLGIQAYYVG
GEGAHGLVRRQGKLTGPTTVFPQPIGLSSTWNPNLMSEIGKVISDEARAYYKKSDKIAGL
NIWAPTVDMERDPRWGRTEEAYGEDPYLTGKLSAALTKAERGEDPFYLKMVPTLKHFYAN
NYEKERISCSSSIDPRNKYEYYLKAFKPSIVEGGAQSIMTSYNAINGIPGMVNPEIQTIL
KDQWGLESFTVSDGGAVCQVVDYHKYFVSHAETIASSIKAGLDSFTDNPDMVVAAARDAM
ERGLMTEDDLDKAVRNIFRTRIRLGQLDPEGYDPYDYISDEVICSEENSKVALKAAREAM
VLLKNENNILPLNKEKLKKVAVIGPLADELLMDWYSGIHPYKVTPLEGIKKKLQEVQVTY
SDGADIVTLTSLLNNKLIAQYQDNENILYANKTELCDEALFKHIDWGWGSHTLRSKANNK
YMSSKRDKEGILAADQEEAFGWFVKELFNFDRDSDNNYYLRTWNWENIGVGEDEKLFINT
GKPKVEVDKYKFKKSLISSGIEEATSAAKDADVAIVVVGNNPVINGKEEVDRKDIILPPS
QQELIKAVYETNKNTIVVIVGTYPFAINWEQENIPAIMFTASGGQELGTAIADSIFGDYA
PAGRLSMTWYKSIEQLPDITDYDIIKGKRTYMYFDQEVIYPFGHGLTYPNFEYKDLLIKS
KNYTNNDTIEVSCDIINTGNIDSDEVAQLYVSAIKSRIVRPIRELKGFERINIKAGEKKT
VNFKVKVEDLAIWDVTRNKYCVEAGEYKFEIGTSSKDIKLEGNVYIDGEIIPSRDLSLKT
RAENYDDYNKVILKNCIKGGTCVSNIDNNSWLCYKDVDFSLSYSTFMAQVANDTTKAIIE
VRIDSLEGEVIGTLEVPSTGGLQNWIINSCEIKNITGIHDVYFTFNVGDRFNGELRISYF
QFITG
Download sequence
Identical sequences A0A173MZS9 D9SMN5
WP_010073070.1.47838 gi|302872951|ref|YP_003841584.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]