SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302872952|ref|YP_003841585.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302872952|ref|YP_003841585.1|
Domain Number 1 Region: 284-810
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.63e-104
Family Glycosyltransferase family 36 C-terminal domain 0.0000000523
Further Details:      
 
Domain Number 2 Region: 1-265
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.82e-79
Family Glycosyltransferase family 36 N-terminal domain 0.000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302872952|ref|YP_003841585.1|
Sequence length 810
Comment glycosyltransferase [Clostridium cellulovorans 743B]
Sequence
MKFGFFDDANREYVINTPKTPYPWINYLGSEEFFGIISNTSGGYCFYKDAKLRRLTRYRY
NNVPIDNGGRYFYVNDGGDVWSHTWKPVKKELSAYECRHGLGYSKFTGERNGVKVSQLSF
VPLGMNAEVHQIKVKNTSDTDKAVKLFSFIEFCLWDAGADGENFQRNFSTGEVEIQGSVI
YHKTEYRERRNHYSFYSVNTEIAGFDTDRDSFIGLYNGFEAPDVVMAGESKNSVASGWAP
VASHGINVELKAGEEKSYVFVLGYVENKDEEKWESKGVINKTKAKEMIEALADDAAVEKA
LAELKKYWDGLLSNYTLNSDDEKLNRMVNIWNPYQCMITFNMSRSASYFESGIGRGMGFR
DSNQDLLGFVHQIPERARERIIDIASTQFEDGGCYHQYQPLTKKGNNDIGSGFNDDPLWL
ILGVTAYIKESGDMGILDEIVPFDNDLNNTATLMGHLKVSFDHVINNRGPHGLPLIGRAD
WNDCLNLNCFSATPGESFQTTENKEGGVAESVLIAGMFVFIGKEYVALCKEIGDLEEAAR
AQKHIDEMTEAVLTHGYDGEWFLRAYDFYGNKIGSNENEEGKIFIESQGFCVMGGIGVEN
GLAEKAMNSVIERLDTKYGIVLNNPAFTKYHLEMGEITSYPEGYKENAGIFCHNNPWIAC
AETVIGRGDRAFEVYRKIAPAYLEEISDIHKTEPYVYSQMVAGKDAVRFGEAKNSWLTGT
AAWNFITISQWILGIKPDYQGLRIDPCIPKDWEGYSISRKFKGAQYDIVIKNPNKVCKGV
ASITVDGKAIEGNIVPTFEGGVHSVEVVMG
Download sequence
Identical sequences A0A173MZW4 D9SMN6
gi|302872952|ref|YP_003841585.1| WP_010073069.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]