SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873067|ref|YP_003841700.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873067|ref|YP_003841700.1|
Domain Number 1 Region: 52-139
Classification Level Classification E-value
Superfamily ICP-like 1.06e-20
Family ICP-like 0.0021
Further Details:      
 
Domain Number 2 Region: 263-317
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000206
Family Type I dockerin domain 0.0011
Further Details:      
 
Domain Number 3 Region: 150-239
Classification Level Classification E-value
Superfamily ICP-like 0.000000000000994
Family ICP-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302873067|ref|YP_003841700.1|
Sequence length 318
Comment Proteinase inhibitor I42, chagasin [Clostridium cellulovorans 743B]
Sequence
MLKKKRTFISKILLVSMCASIVPATVALAGENAVVKKSKSNEIQIIPMPGNVKESTSISL
KSNATTGYSWKYTVVQGDSIIQTLKSYRPDDTSGTIDGSGGTDTWTFKGSKEGSTTLRFE
YSRSWEESPVDTREFIITVDGDMNMTVKETTKGTASIQLRSDTTTEACSWRYSVVQGDSI
VESSKEFIEYPVWTGIYGSGGRNIWVFKGLKEGSTTLKFEYLRPTEGDVAEIRDFNLTVD
KDLNVSVTELSDQSKAGPSSQRVADINGDGNVNLIDLALLKKYLKDNTIGISKYVGDLNR
DGQINSTDVNLLKMALLR
Download sequence
Identical sequences A0A173MZQ0 D9SNR5
WP_010075308.1.47838 gi|302873067|ref|YP_003841700.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]