SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873140|ref|YP_003841773.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873140|ref|YP_003841773.1|
Domain Number 1 Region: 419-623
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000029
Family Pectate lyase-like 0.095
Further Details:      
 
Domain Number 2 Region: 181-461
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000011
Family Galacturonase 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302873140|ref|YP_003841773.1|
Sequence length 743
Comment hypothetical protein Clocel_0225 [Clostridium cellulovorans 743B]
Sequence
MQNIISMKIDLKKESYQNNVAQQNDDMVLDINIYGDGDIISLEGATAQLSYINANNTIAT
ISGSEVVVSGNNVKITCPRDCTRSAGIAKMKLVIISASKQVSTFPIEITVVPDVVQGQEV
SGNVATVIEKLINENIICNDTLVRLQNWVATHGDIVDLDSRVDTLELDNTQDAKIIQGTD
YLDINAEIMLYTSEGYKIKFKRMTYDLTGTILIPSDADIDGNGCTWRRKVDDIARGVFDI
AQNIDETNGNVNIRIANVTIDGNRQADQLVNTIDNHRFSGLKLTKVTGESFISNVTVINT
VNGEDLQTTPAGGIFFVDCKDIRCSNLNGWYNLGTAIIIRFSSNITIDGSLTYDNEGSGI
SGRGCPNCKYLNIVTFNNKFSNLSVNGVDSIVDNVISYKAGYSGVNIGHPDKDATTKYYA
NAHGTVLSNIISFDNTYEGLTIGGSDNVSCTNVIVYGNAINTTRENIRIHGNSNSSKLIN
ITSRDCATSGIRYYSGTNHVLDNSEFYNCKCGVYCGPDTSVTIGGNVKIHNNSLDGIILA
SAIKCTVACEVYSNGEYGIWISGGSKHRIVGADIHDNILKDIYETGSPVDLYYDIGNKGI
TYLSNGVVQVTCIKSVTDEVNTPVFRVQLPDHGRLSVDFAITTFYPASVSAICHMVKGVA
VASATGGGVINSQTTVFGTATAVSAGLSQVITPSLVKDETNDYIEFIVNQNNETVDAAGT
INITATITYAIGSNVVRPTVTLL
Download sequence
Identical sequences D9SPG0
gi|302873140|ref|YP_003841773.1| WP_010075228.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]