SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873141|ref|YP_003841774.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873141|ref|YP_003841774.1|
Domain Number 1 Region: 183-276,309-532
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000106
Family Pectate lyase-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302873141|ref|YP_003841774.1|
Sequence length 691
Comment hypothetical protein Clocel_0226 [Clostridium cellulovorans 743B]
Sequence
MQNTISMSIDLKRENHQNKIVQQNDDVLLDIDVYEEGKIKNLEGAIIDLSYVNANNTISI
IAGNSMVVSGNNVKITCPRDCTRSAGVAKMKLTIVSDSKQVSTFPISITIVPDVLEGQEV
SKNIATIIEGLTAANTTATITYNELMQAIELGNIPQLTNRVVNLEKEVNRIEPSQFIEAG
DTCDVESINRMIQYASANNLVAFIPKRFSDYIINSPIYVPSNITLLSNGATIKLADKSNC
RYCIVNEDRINGNSNIKIIGLRINANQTNQNDSLIIGNIIGICFESLSNTSACHDCMAIL
NYIYDSSIAIRSWVSDENLTGSRMHCYNMTFSHNTLEKCINKIIELGVTDRSLVSSNVCK
QCTDGIQVIFNSNYNMVSNNIIECTATGLNITHNSCYNTFTNNYVSGYGYLLIMRADAQN
TTSIIKGNKITNNTFQMSQGTGTIFSFSKLGSATGSMEYYDNDISNNSFLGYSSSATAFL
RLYNFSSNDVSCKIDKLFLNNNTFANCAIVAGSVDRVNCTVGDIILNNNTYTESYVIPGK
VAYLYIQGGFFKFDTLNTAIQYNSSSNPTNIFISDLVVKAAKLFIALTNSAHTNTISIKR
CNVESASTSESVAVHNCNFFFLDNCDIITPDANLGVYFSNITGFSGKNNRIFGNSRGFSQ
KVGSALGGKMTSNEFYGTTTSYENMNNFTIV
Download sequence
Identical sequences D9SPG1
gi|302873141|ref|YP_003841774.1| WP_013291582.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]