SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873185|ref|YP_003841818.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873185|ref|YP_003841818.1|
Domain Number 1 Region: 1795-1841
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000051
Family Invasin/intimin cell-adhesion fragments 0.01
Further Details:      
 
Weak hits

Sequence:  gi|302873185|ref|YP_003841818.1|
Domain Number - Region: 593-681
Classification Level Classification E-value
Superfamily PKD domain 0.000785
Family PKD domain 0.018
Further Details:      
 
Domain Number - Region: 496-584
Classification Level Classification E-value
Superfamily PKD domain 0.0294
Family PKD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302873185|ref|YP_003841818.1|
Sequence length 1848
Comment hypothetical protein Clocel_0272 [Clostridium cellulovorans 743B]
Sequence
MSKKVPKSKSKNKASRPYAVFSYAVIASMLAQITYPLAPVYAVEQVATTQDNINLVLSQP
KPIDVVLTLGSTNVNAANFQNDLKAKLQAKGVDLNRVQITAIDTKQQNLQSSFTWIQNVS
SSIGSIAIQNNGTKIQMFGNPTNAGFNKIYTANNNDPELKEQTMNFDYTLDFGDSFDGAG
VLFNTNVVNGLLSGYAIFFPQSGGGVARIYKLTNWTNTYAEDISSNANAQQIGTMNMGTS
GSFTLKTTKNALNVYKSGAFLGTIALPQHFGWGLGFFGDHYSHGCNRIGEFSLNNISLSQ
TKSKEFNEIIRQPSWRDDSQRYVVNLADQTINDFDSPTVSGEILTRLINENIHFLELGTD
ANKVQSENFIQRNNGNGAFYYNNNYDVAVTNVADYIVNRIQNTDQPQDSPYVLAGTPLNI
NVSPEQFKTNTANADYPQGRWKLDQDFNYFDNNLGQETWSNQWRNDLPTEIDKPGKYELW
FGDTHPSPQYIYVHRKPVANFSVGLSKGASSATATVTNLSYDPDKQSDADKGIAEVEWKW
KETTATTWNEGALPSDLPLGKNYLVQLRVKDYQGTWSNETASYIATDTAVVTKPVANFTI
PSSTITMYEPLNVQDVSYEPSGRAIVDKTWTITKTGTVVYSGATLPANFTGIGSGNFVIS
LKVKNDAGLWSEAYSRGVTVTVDNLAPEAIITPASTPWGTTDVTVTAKFTEPGGSGFSGQ
RYAISSSPDAPTTGWSDWSTSLDREVTVTDSGKIYVHFEAKDNAGNLLKRTVGPIQIDKQ
TELNAPIIHHDKDSFTIDTNNPNSPSGIKEVLYKINDGEWIKAGADNVIPDGTYTISVKV
VNNVGLESPVTSEVITFAISYDNSKTALDLAMNLLLQLEAKTPQILQTDVYTQATLDQIK
SQVVYATDLAPKIVDEAQKLEIEARIKFLNNRIAIIQHLITSRDLVATISGDVNSFVIKS
QTGTSFDFSLITREKIELINKNIEDAKASLEGLPSCLGKTLLQIQIDVLIDSVTSAGYAL
DAFEATTKVDGSIVDLSTQEYINIAIANYNAAKDKVSLLPCGQTKLDLLNKLINIRITIE
IAQQILDAKNAVANIEGLGLGLNSTQDDINLAINLYIEANALVQNLPEGPAKEELKERVT
KINIDIDIAKKLLIAKAAISKLEGSLPNENSTQIDIDIAVKLYIDAKGLVDLLPEGDAKE
TLKEKLVSINITIDIAQKILDAKNAVVKLEGVLPNENSTQIDIDIAIKLYLETQGLVDAL
PDGPVKQGLKDKLVSINITIEIAQKILDAKNAIIKVQDVLPNENSTQVDIDIAIKLYLEA
QGLVDALPDGPVKQQLSDQLLQIKITIDLAQNILNAKNAVAQAEGLILNENTSQADFDIA
INIYLQAKGFVDSLPDGDLKEGLLSRLVAVKINIDFVQTILNAKNAVIKAEASVPNDYST
QVDIDIAIKLYLEAYDLVDALPDGQVKQDLLNKLIQIKITIDLSQTALNARNQVVKAETA
ANSISVQVDVELAIKELDTAKALVDALPDGNLKIELKLKIEAIQARIYEGQADVYVKIAE
TASVSLPTYDAITIAQKAKDFAEVYIKESVGNATAATALNDRLLQVQIKINIAIATLKTN
QASKTLDLADVDIAQKAIDILPDGNEKTAIQIRLNLIISIINSTGDVDNLRKMLVDLQNG
LKGVDLNLILLFSNRDKLNDLYSKSDALINAYLKIAPSIYTLGANDPTLSCAEKIKLGEL
KSSLSEISGLSRSIRIILDDSTGRSKVDDGNVHSVFKFMLGSRSVDLATNFNNTLLLDLD
RTDNIQWVSLHGAVASVNDAGVVTRKSMGIAKIAAYNDHGVYYFNLAL
Download sequence
Identical sequences D9SPK5
gi|302873185|ref|YP_003841818.1| WP_010075181.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]