SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873208|ref|YP_003841841.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873208|ref|YP_003841841.1|
Domain Number 1 Region: 72-356
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.00000000000019
Family CPF0428-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302873208|ref|YP_003841841.1|
Sequence length 607
Comment hypothetical protein Clocel_0296 [Clostridium cellulovorans 743B]
Sequence
MLKPINTKNIKLLPSIFKERYDLNRNYLINVKNQGLLQNFYLEAGIILPGLQVLHNPDTD
EIHWGWDAPTCQLRGHFLGHWLSAAASIFVSEQDHELKAKLDKIIDELIKCQELNGGEWI
GPIPEKYFQKLENSHHVWSPQYVMHKVLMGLMNSYIDTNSDKALAILDKLSNWYIKWTDD
MLIKNPRAIYGGEEAGMLEVWITMYEITAEEKYLELAKKYSNPRIFRDLEAGRDTLTNCH
ANASIPWSHGAAKLYEVTGDEKWRKITEAFWKNAVTDRGYYCSGGQGAGEYWTPPFKLGL
FLSDSNQEFCTVYNMIRTASYLYKWTGDTSFADYIELNLYNGFLAQQNKYTGMPTYFLPL
GAGSKKKWGTETRDFWCCHGTMVQAQTLYNSLIYFEDKERLVVSQYIPSELKWNYNNTDI
TIQQRVNMKYYNDLAFFDERDESQMSRWSLKFQVAAEKNESFTLSFRVPKWVKELPSVTI
NNEKIDDLTVDEGYINIKREWSQDEVLIYFPCRLEISPLPDMPDTFAFMEGPIVLAGICD
EERRLYGDADKPSEILMPQYQHTYGVFPWKQGIYKTINQPENITFMPLYEITEERYTVYF
NRDKSLL
Download sequence
Identical sequences D9SPM8
gi|302873208|ref|YP_003841841.1| WP_010075158.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]