SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873221|ref|YP_003841854.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873221|ref|YP_003841854.1|
Domain Number 1 Region: 25-259
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-73
Family Kelch motif 0.0000316
Further Details:      
 
Domain Number 2 Region: 217-368
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-43
Family Kelch motif 0.00045
Further Details:      
 
Domain Number 3 Region: 361-441
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 1.73e-17
Family Invasin/intimin cell-adhesion fragments 0.0046
Further Details:      
 
Domain Number 4 Region: 451-521
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00000000000000365
Family Invasin/intimin cell-adhesion fragments 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302873221|ref|YP_003841854.1|
Sequence length 596
Comment Ig domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MGLKKELKIKTGIIAVICTLMFIIGSANLISVKAATFATPSNQWVPVASMSGTRHWQNSY
VINGKIYVMAGHNGSVSIASVESYNPATNTWTVMASMKEPRHYYTSVELDGKIYAIGGHN
GSKGLASAEVYDPETNTWTSLPNMKEARYYTSAVVCNGKIYVVGGHNGSAVLSSIEVYDP
ATNTWTTSAVMKAARYAHTSVELNGKIYAIGGFDGNYLSSVEVYDPVTGIVSLLPSMNNT
RHYHESVVLDGKIYSIGGKNANCLASAEVYDPEKNTWTLLPNMKDSRWYFDLFTYNGKIY
ATGGGNAVYISSVEVYDPITNKWSSLPNMLSTRAYHTSVVLNDRIYAIGGCNGPALSAVE
AYQIYDIQINKGTSALRVGETDTLQVTKIPAEIQVNWTSSDPSVATVDDNGKVTAIKAGT
ASITAKATDGSNYSVTCVVTVTGEPKIDTILKLNKTAISITIGQVEPLLAITNSPSVTWS
SANTDVATVDSNGNVIGMQKGTATITATTADSKTATCVVTVNAKSRANLIITMTNNNIKT
YDLSMEALNIFLNWYDGRANGMGKSYYIFVNPNNGYKEYIPYDKIEYFNIEEYEVN
Download sequence
Identical sequences D9SPP1
gi|302873221|ref|YP_003841854.1| WP_010075143.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]