SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873302|ref|YP_003841935.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873302|ref|YP_003841935.1|
Domain Number 1 Region: 284-780
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.09e-85
Family Glycosyltransferase family 36 C-terminal domain 0.0000000313
Further Details:      
 
Domain Number 2 Region: 1-276
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.14e-61
Family Glycosyltransferase family 36 N-terminal domain 0.000000673
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302873302|ref|YP_003841935.1|
Sequence length 795
Comment glycosyltransferase [Clostridium cellulovorans 743B]
Sequence
MNYGYFDGENKEYVITKPNTPAPWANYLGSPEYGAIISNNAGGYSFVKSGANGRIIRYRF
NAINMDQPGRYIYLRDNDNGDYWSGSWQPVGKPLDKYENQCHHGTAYTNIKSKYTNIKAE
TLYYVPLDKTYEVWRVKVTNEDTKVRNLSLYGYVEFSNENNYEQDSVNLQYTQYITKTYF
RNNKIIQTINENVKQSVNGSTGKERFFGVAGAEVAAYEGDRDTFVGEYRNYSNPIAVESG
KCQKVLNYNTNSCGALQIDITLNPGETKELAFVLGAHNDDASSKILASYEDLSQVEKELQ
ELKDYWHGKLNNFQINTPDENFNHMINTWNSYQCFITFVWSRAASFQYCGLRNGYGFRDT
VQDIQGIIHLAPELALEKIKFMISGQVDNGGGLPLVKFDHNPGHEMTPDDPAYTYDRYRA
DDALWLFPTILKYINETGNDDFLDEVIPFANKGEATVYEHLKRAINFSMERQGNNGMPAG
LHADWNDCLRMGAKGESTFVAFQLYYAMAILKNIATDKKDDAYVAYLDEKLAELKETMQT
KCWEGDQFIRGIREDGIVVGSKNDPEANLWLNPQSWAVISGCADKEQCEKALDKVYERLN
TPYGAVLLDPPYKDHAFDGALMLLFNPSTKENGGIFSQSQGWIILAEALMGRGNKAFEYY
RECSPAEMNDNAEVRKLEPYAHGQFIEAKESPFQGRAHVHWLTGTASTVMVGCVEGILGM
RPTVDGLNISPSVPSDWKEFSIFKSFRGKKLNILVKNPDGKEGGVRELIVNGEKVEGSFL
PVSMLKEENEIIATM
Download sequence
Identical sequences D9SQA4
gi|302873302|ref|YP_003841935.1| WP_010075063.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]