SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873466|ref|YP_003842099.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873466|ref|YP_003842099.1|
Domain Number 1 Region: 372-664
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000523
Family Galacturonase 0.02
Further Details:      
 
Domain Number 2 Region: 691-949
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000319
Family Galacturonase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302873466|ref|YP_003842099.1|
Sequence length 3288
Comment YD repeat-containing protein [Clostridium cellulovorans 743B]
Sequence
MKKFKRFIAFFLIFSIIFTQNQQILVDTFKNVDLDINLGVLSNITLPTIPTSEKTTTTQN
RDIPNLEQMHTLELEELNNLTTENQSITMEKQNLLSFQTPSIIEVRSINDSTNLINWTYE
EDFEYQLEVDGQIVDLKSVKGYVHNFDSNNKTHIYRIRSKSQEQFSQWSEAVTKATEPGK
TLTDSVLPIDRNLLKRRIPTATNPIVALTDTISEPSVQYEVHVKGAPLSDWQNSKDGRLI
VTNGIDAIKVSLLSPPSGLKIKYRVYSENGTWQPWTYDGGICGIYGKNIQMIEMKLEGIT
TSFSIGYILTNNANQESFPLEMDGETSGTMGTNSGIFLACLVNNNDSKVEVIDKDTTWKK
SEGPHIIDGIVRVEPGVTLTIEPGTKVIFQKYKYRENGLYINGKVIMEGTPSEKIQFSSM
VDGQAVSTDQYYFRGIYVLPTGEIKASYVDMELDRKDNYILVNGDVSFNYCNFNCVGDSG
IDWNYVIYAKVEREKVLNVSNCTFSNAGQGIGLGDSFGEVNITNNSFSNTIRDSIQVGIS
DYETYSVLANIKANTIVGGKNGISLKGIRSNIVNIKVTDNVIKNCSETGVYIEEYLGSLT
FQRNTISGVDTNRVKELSGPIVVKVEKLGTNFSSVISAVNPKDVALKNTLSGNNFDAIVL
NGTINENSRLFNGTNRYLVRSYLDISKDKTLSIEDGTIIHLRGEVVVYGCIRSEGKANNQ
IVFTSVNSEYTLPYKPTSDPAQKIMDDFFPWINIRNSGSFLGLNTVINRGGGPRKAGGPG
YCSINLDGKLTLINSSVFNSTNAGIDAFKDNESTEPSDLTIINCSITHNMGHGIWIGHIP
ATIINSDIHQNDSGIVTFADDTVIAGNSFVGNRTSAVNYWNDTKDKYIDLRNNYWGASDG
PYATDTGGGAWEGKGQKVNVYPGYAVVYPFLKTPSDCVPVGDLNNYVRSVQLRDQKWFGS
QGVSVATGNYCKTFMDMEDCFPNLGLSLSHTYNSKDETVSILGKGWRLSLQGEISDFSSS
AGTAMKKVVLPSGETQTFTVNSNGTFTANDSRNTLTKAGDTFTLTNKEQMQYLFNSSGKL
YCVKDKNGNAVNIAYDNGKIDRVYDETNKSFKLTYDAATGYIDKITESFGTVTGRIVDFN
YDSSKRLSSVTDASGNVTNYVYSGIGLLQDTKSGEGALLERIIYTLDGGSYKVRQKIDNY
GNSFTYKYDDFVNRTIVTESNGWVKEYWCDSYGYPTVTIYPDRSTENKEYYLDASGENKY
GEIKASMDIYGNRTEYIRDGRGNVTKQINPDESEKNFAYDDKNNLIKEVNEDGNVTYYCY
DANKINLIQKVQPLNGTDPLVNPLDETKFAITSYEYYSETERVQNGYKVKGSLKTEKTPL
GNTTTFKYDANGNKTVVTDGFGNNTVYTYDSYNNEASMTTSEGYKTTYVYDMNGRLEKAT
LHGGEVTRTVYDNEGQKLKEITPNIYDAALDNIDAHTYSGEHGTRFTYYYNGKVATATDA
MGNTTRYYYDKYGNVSKEIKPNKSVYLYQYDCHNRPIKTTFKESDASTTEILIEEFNYSL
SYDRTLESNVLIKSHKQYIDNTNTVTSILKFDYANRLVKVKNSDGTEISTKYTPSGLKLI
EKDEDSNETLYNYDALGRLIKKWTPISENDDVTYYSYSGFQYDKDGNKKVEWTGKNLVEY
GVSVSILDPNAIKLTYDYYKDGKVQSKVDNEGRRTDYEYSKDRVLTKETVFLTYGGKYEI
TEYRNNYLGKPIKTLVKTAKQDIIGNSITDSALSNMWTTYEYDKNGNLKNVKNYGVVDGT
DILSTTPVLNVTSYEYDNLNRETKQTKQAKNTAGNDTTIFTSKNYSWDGKVLNSRDGNGR
VTTNTYDLRGRLVKVRDPKGQYTLFTYDYLGRVLSKTISRLNEDYNSYIQKFNAAINTTP
DSPNWDPEYDFNKDNVVDLYDNVIINRENIDKTLFEYDDMGRVIREIKSSRNPNTLAWDN
VTTKAYKYDNQGNVIKELDALGYEQGSGATPAEKIENGYGTEYTYNLLNKQTSVLTPASK
DKGLAFNSKYEYDGLGRVVKDISANQGSYTYEYNNSGKLTKTTLNKKDGSQLVIKTNQYD
LGDNLISEKDAKGIETKYEYNLLGKIRKVTTASDATINANTIQYQYDIYGNQALSQESSG
RVDLTEYDNAGRKIHEKTQKSDGTQVIEKFYFNDGNGNVVAFIDGNGNKTTSTYDEQNKI
TSKRINVTYVDGSTKENRITYEYDIFGQLISETDPLGNVLKYKYDAFGRVIDKRDAYNKV
IQILTYNANGSQKESFDALNNEITYIYDKDKRLIKSINGDEATGTIAAEQVYDERNNVIE
KRDGNGNSTKYQYDELNKLKSVTNALGQVTSYTYDDNGNMETMTDGNGNVTYYEYNCANK
PIKIKTLKKDITTNVSGNTVDLSTANLSEGYTYYVDGNIKTRTSKNTDVTTYTYDIYGRK
LTEVIGSINNSYTYDKNDNLLTVKDSTGTTTRTYDALNRTITKDVPNGGTTKYLYDSTNG
VDPGCYAEVSTDAKGFVTTKIFDKAKRLYKVTESGNTTTYNYYDNGNRQEVIYPNGSKEV
YYYNKNNTLAKLENKNPNGSIAESFVYEYDNSGNITAKVDKKGKTIYTYDRLNRVETTTE
QDGKITTYKYDNAGNRTSMSAVFGSNVETTEYYYDSLNRLRYSHQLLTGIQDSGVALTAE
KQNSKYDYDENGNQIKVTETSYDSTKQQNVVKETINKYDKLNQLIETTTKDGVVVKNAYN
AEGYRVAKDVNGVKTNFVYEGDKVVLELDASGNEKGRNIYGENLISRNADGQKVYYLYNG
HSDVTTLTNEAGAIIGTYYYDEFGAVEESTGTVDNPFLYAGYRYDKETGNYYLNSRMYDP
VTARFLQEDTYRGSYNDPLSLNLYTYCYNNPLIYDDPTGHWLHIAIGALVGAVAGVAINA
VSDYLDDGKFNKGWKSYAGAAVEGAITGGLAAATGGLSLGATIAINAGASFVGNVAGQYI
SKGEVNWKEAAVSAVVGGGGAAAGHYAKKIVSKLPSIPKPPVISRAEQLLNKAKARVKVL
GDAGMSRLNQISDNIASKISSKLSPQMSFAGVGNINLPKTSFRGNVKEVGIFKKADTSVQ
KNFKDVVKTNEKRIEALNSSGGINKNINKTQSGSKSFYTVQNAEDGARLLNDGTPWPTEP
HKANLGEGVYSWDNLEDAENYLKLKKRRTDVELNIYEFKVANKDLAKMKSLDMTKLPDDE
VDAFLDIHAKLNGGTPNHGLEYIRRATNIGVENYFHSSVFKYLKFTKK
Download sequence
Identical sequences D9SR47
WP_010074888.1.47838 gi|302873466|ref|YP_003842099.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]