SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873548|ref|YP_003842181.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873548|ref|YP_003842181.1|
Domain Number 1 Region: 2319-2835
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.76e-98
Family Glycosyltransferase family 36 C-terminal domain 0.000000412
Further Details:      
 
Domain Number 2 Region: 2049-2310
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.79e-73
Family Glycosyltransferase family 36 N-terminal domain 0.0000199
Further Details:      
 
Domain Number 3 Region: 1558-1818
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.44e-71
Family Glycosyltransferase family 36 N-terminal domain 0.00044
Further Details:      
 
Weak hits

Sequence:  gi|302873548|ref|YP_003842181.1|
Domain Number - Region: 589-617,674-760
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0225
Family Molybdenum cofactor biosynthesis protein MobA 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302873548|ref|YP_003842181.1|
Sequence length 2836
Comment glycosyltransferase [Clostridium cellulovorans 743B]
Sequence
MMDRLENHALDISQNFSETKEANSKQAIRKLLDESYKEIIKGYEYIDKDVRDKKEVIPAS
QWLLDNLYLIEKEYKDIKFKTPNFFYKRLPVLTKGELAGFPRVYQIAASIVAYTEGKICK
GSIESFINAYQEITTLTSCELWALPIMLKVALIKNISIVTRQMAFAQKEKKIGDSIADEL
VIYSDDEERINKTLNSIDIENPLSSHFIERVLKTLRDNGCENPRIYKWFDEALDRQGDNA
ERMILIDHQKQGYFQLTLDNSISGIREISSISWSAFFEEFSFVEKLLRADPAGVYKKMDF
DTRDYYRHKVECYSRKFKVSETYIAKQLLECAGNETEEHKRHIGYYLIDEGIACLKKEVN
YKDKWVDIIRSHLRKNNATYYIFTIVLGTILLELLIMLSTYRNDSNVIIWKYIIAILVIL
IPCSEIVNAILNWSINNLIQRRFVPKMNLEDGIPDEDKTIVVIPTIIDSEKRAEELARHM
ETYYLANEDKNLYFAILGDYVDYKSEHKDNDEQIKNAALDAIHRLNKKYASIKEQRFFYL
NRKRQYNEKEKLWLGWERKRGKLMEFLDLLKGNEKVSYNVISGNLSNLRKSKYIITLDAD
TQLPMDTAKRLIGAMSHVLNRPVMDKGGKQVLRGYGLMQPRINISAISANKTMFARIFSG
DIGIDTYTMAISDVYHDSFGEGIFTGKGIFDIDTFHSILNDAFPENAILSHDLIEGSFVR
CALVSDIACIDGYPAYYIASIKRLHRWVRGDWQLLPWIFKKSVLNGLSRWKMIDNLRRSL
ISPSLIILVMLSFQVLPLNNELWLAIAIIALITPLLFDVSEAIVAPIKGISLSGKISQGK
NVIEQVFLIFLFLPYNGYIMLHAIITTLYRLFISKRNLLEWQTAADAEAKSGKTLKSYIQ
YMWQGSLIGLIIGILAFKHDIYAGAWAMPSVLLWIISPYVAYLISRDNLKETVEFSESER
IFIRKVARKTYGYFEDFVGEETNYLAPDNYQEDPYVGVAPRTSPTNIGMGLTALISAHDL
GYIDIFNFTNKFEKIIDTMENLEKYKGHFYNWYDTQNRKPLCPKYVSTVDSGNLLSYLWL
IQSTFKDYLNKPILDSTLNEGLKDIMNLVEEELGSSLKNKDFFTNIKAGMDITEFNIITF
RGALRKIADAVREIDNLVASENLESYWLQKLKNSLKEHRKALDNLFPWLETVEGDLPTYE
KILEPLNNLGSSILLKDVPAASEKLIENLKKGKFNLKDKKTNSILMEGIEKGNRSITALM
LSLKTLSSACRKFGNDMDFHMLFDKGRMLFSIGYNVEHDKLDNSFYDLLASESRATSFIA
VAKGDVPQHHWFKLGRAITLMDGKRKGLVSWSGTMFEYMMPLLIMKSYPDTLLSNTYISV
IEGQKDYGKKKTVPWGISESAFYYFDTLKNYQYKAHGVPGIGVKRGLRDELVISPYSTIM
AMQLDLRSGLENLKELSKEGLEGKYGYYEAIDYTKERLPQGMNKAIVKNFMVHHQGMSLM
ALNNILNKNIFQERFHRIPRVRATELLLQERMPKQVVYDREVKLDTSEITIDKSNIILRK
FSTPKTPQPEVVLLSNGFYSTMLTTSGSGYSKVQDMMLYRWREDMTINESGMFIYIKDVN
ENKFWSATYQPTKKEPDEYKVVFALDSAVFSRTDDKILTETKIAVSSEDNVEVREVFITN
RSNKEKTIEVTSYSEVTLATYSADAVHPAFSNLFIGTEFDEELSCVYANRRARAKGQMVP
WMMQNIIVEDKAHGMIQFETSRENFIGRNRDLSEPEAMVSDSKLKNSEGAVLDPIISLRR
RIKLKPDESCKVYFVTATGCDKEEIVTLARKYKEVNHITNVFSLAKTHSDMELKYLGIKY
PQANLYQFMASRILFLSDNLKDRENYIRGIKLGQQALWAYGISGDLPILLLKVYKIVDKG
LVKQVLKVHEYWSMKGLKVDLIILDMEESSYAKTVATYIRDTIASSHVRERKNKPGGVFF
YDRGMIPEQIIELLMGISRLVIDANNGLLINQIRFTEKPVELEKLPVLKEKKYNYQDTEI
KLPKLEFYNEYGGFDEENNEYVISLKDGKKTPAPWINVISNESFGHHVSEIGVSYTWHKN
SRENKLTPWNNDWIRDTPGEILYLRDEYTGDIWNINASPIRDEKQYLVRHGFGYSSFEHD
HIGIYGKMTLFTPRGENLKIISVKLKNNSDEKRKISLTYYAQMVMGVIPEKTSGQIVTSL
MDKCITAENPYSQSFNGLYTYLTIVGGSSLSYCGSRKEFLGREGKLKEPEALKYKNLSNK
VGGGIDPCLSCQSKIEIEPSQEVELLVLLGEDDEKQKIESIIKKYSKVKKAEEALKEVKD
FWIDLLQTIKVKTPDKAMDLMLNGWFMYQDIACRVWSRTAFYQSGGAYGFRDQLQDVMSL
SYLRPEITRKQIEYSSTRQFLEGDVQHWWHPVVDSGIRTRFSDDLLWLPFVVADYIKNTG
DYSVLDEMTPYLEDEPLSDGEDERYTISKVSEVSGSIYEHCLKAIERGLRLGEHNIPLMG
SGDWNDGMSTVGNEGKGESVWLGWFLYSILKDFTKIAEFRGDGEKSNYFANSAEELRKNM
EKHAWDGRWYRRAYFDDGTALGSIENDECQIDSLAQSWGVISGGASKTRAIEAMKSMEDR
LVLEDKNMILLFTPPFDKSKLEPGYIKGYVKGVRENGGQYTHGSTWVILAYAMLGDQEKA
YKAFNMLNPISHTRSHLDCQLYKVEPYVVVADVYSADGNYGRGGWSWYTGSAGWMYRAGI
DGILGLKLNYGKGFKVEPCIPESWDGFEITYKKDGAVYHIKVERSESKAIILNDKPITED
FIPYQKPGEYKVKVYI
Download sequence
Identical sequences A0A173MZY2 D9SRQ0
WP_013291606.1.47838 gi|302873548|ref|YP_003842181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]