SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873600|ref|YP_003842233.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873600|ref|YP_003842233.1|
Domain Number 1 Region: 256-553
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.73e-73
Family beta-glycanases 0.0000444
Further Details:      
 
Domain Number 2 Region: 7-147
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-23
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.03
Further Details:      
 
Domain Number 3 Region: 157-254
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000183
Family beta-Galactosidase/glucuronidase domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302873600|ref|YP_003842233.1|
Sequence length 558
Comment Beta-glucuronidase [Clostridium cellulovorans 743B]
Sequence
MNTRLFQNHIVRKEIHLNPVWDFHTLNSEDKKQEAFKMLVPGCWESTPKLASYKGKAMYS
KKVTFGGNIRLVFKGVSHTAYVYLDNKQVGYHYNAYTEFSVLLQDIPYGEHLLEIKVDNS
FHQESALHVTNDYYSYGGITRPMVIEEIDEMFIKYVHFIPYRENNKWYASISASISNLSN
EQKNVTLQIRIGDEVVSFANKALLPNAETLFENTFEFSSAIIYTLENPKLYMMNAMLLYN
DEVVDDLIDRVGFRDIKVNGKDILFSGKKVIIKGVNRHEDYAEFGCAIPIEAMYRDIEII
KSLGANCIRTCHYPNDERFLDLCDENGILVWEEAHARGLNEEQMKHKNFEKQSSDCIKEM
IENHINHPSIYVWGILNECVSNTEFGRSCYAKQFKLIKSLDSSRPVTFASLEAHIGSDLC
LDLVDIVSFNIYPGWYHNTPLKDSLNALKNFVNSKEGAGKPLLISEIGAGAIYGFRSNNM
EKWTEEYQQYILTEQLTSILSDEELSGVIIWQYADCRVDNGWFHGRPKCQNNKGIVDIYR
REKLSFNKVKEIFHSYLK
Download sequence
Identical sequences D9SRV2
gi|302873600|ref|YP_003842233.1| WP_010074750.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]