SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873635|ref|YP_003842268.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873635|ref|YP_003842268.1|
Domain Number 1 Region: 22-329
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.84e-38
Family Pectate transeliminase 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302873635|ref|YP_003842268.1|
Sequence length 334
Comment polysaccharide lyase family 9-like pectate lyase [Clostridium cellulovorans 743B]
Sequence
MKKIKTLCMAAALGAVVAGASLIPATSAYAATTINVSSTGTSLSSALSKAKAGDTIVIKG
TVKSGAVNVPAGITITGNGTGKIDFSSTSGSSGRGLTIKTNGSTIRDLELYNAADNGIYV
EGSSNKFIKLNVHNNKDAGLQFSNGASNNYLSFVYSHHNADAAGENADGFAIKLHSGPGN
VLEDCTAEGNSDDGYDLYAAHGAVKFVRCKAIKNGECGGIKGDGNGFKVGGVDNKTSGVA
AHLDPLKHTLIDCVADGNLKRGFDRNNQSGVVTMTRCIGKNNAGGNFYFPLNGTPSALGY
KVTFGKAIIDSCTSSGGGSNNVTGVTFKGTNTGF
Download sequence
Identical sequences A0A173N002 D9SRY7
gi|302873635|ref|YP_003842268.1| WP_010074715.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]