SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873801|ref|YP_003842434.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873801|ref|YP_003842434.1|
Domain Number 1 Region: 9-195
Classification Level Classification E-value
Superfamily CAC2185-like 1.83e-61
Family CAC2185-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302873801|ref|YP_003842434.1|
Sequence length 201
Comment hypothetical protein Clocel_0900 [Clostridium cellulovorans 743B]
Sequence
MVSKIESVPNLKNENFSIICNNCIGGFIYQYYNIEYKTPTIGLFFLAQDYVKFLSNIEFY
LSKQLEFIDPKESIHFEQFKRYVDSINFPIAKLDDIEIFFLHYKDQEEVIEKWNRRMSRV
NWKDLIIILAENETCNYEVIKQFDALPFNNKVCFTKDHYPEIQSACCIEEMKDPTRLWDV
EIIMKHFDITSFINNRIIKLE
Download sequence
Identical sequences D9ST54
gi|302873801|ref|YP_003842434.1| WP_010076489.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]