SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873806|ref|YP_003842439.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873806|ref|YP_003842439.1|
Domain Number 1 Region: 50-382
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.56e-75
Family beta-glycanases 0.0000000157
Further Details:      
 
Domain Number 2 Region: 567-753
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.31e-53
Family Family 28 carbohydrate binding module, CBM28 0.0000149
Further Details:      
 
Domain Number 3 Region: 382-557
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.39e-48
Family Family 17 carbohydrate binding module, CBM17 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302873806|ref|YP_003842439.1|
Sequence length 757
Comment cellulase [Clostridium cellulovorans 743B]
Sequence
MNIKKNILNVVMAIALLAYSIPVSVNATEADYSNLIVSPAEKPSEGGALQILEKSGQKTI
CDQSGKSIQLRGMCTHGLQWFPGTINNNAFAALSNDWGSNVIRLAMYVTENGYNNDPIGM
KEKVIKGVDFAIANNMYVIVDWHMITPGDPNAAEYSAAKAFFEEISSLYPNNPNIIYELC
NEPNGEAPGVTADANGWIKVKNYAEPIIKMLRDKGNKNLVIVGSPYWSHRTDLAADNPVI
DSADNTAYAAHFSAGSDYPTTDDTDRRKVMTSIKYALNHGVAVFVSEWTLAEAGGMIESG
GLYYDYADNWLDFFSKNNISWCAWSICNNNYTSSSLVPYEMCKTNETSLDPGDDQLWSPN
EISPAGEYYRARIKGITYNPIDRKKVDFTTNLFDFDDDTTQGFGINRDSFVKSVMLSNEN
KALKLNGLSASNDISDYNFWGNARLSAEASGLYKDIKDAENLTMDVITATPATVSIAVVP
QSYYHSWIDPKNAVQVVPEDFKLQQDGSYKATLTISSEDSPNLKAIASDSKDSILTDIVL
IVGSTTSAISIDNIAVSGTHTIVDQPIVHSPIGTPTIPSDFEDSTRNGWDWDKNSGVKGS
LTIEEANNSKAMSWYVQYPKVKPSDLWTASPHIRLIKAKATPVANNYLTFDLYLNPISAS
KGSILIYLVTESPELGYWAMASEKYNIPLTNLNQVEKTTDGLYHYKVNFDLRKIDGDKVI
LPNTNLDPLTLVFYDVNCDFDGKMYIDNIKFSNDITQ
Download sequence
Identical sequences A0A173MZR0 D9ST59
gi|302873806|ref|YP_003842439.1| WP_010076484.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]