SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873829|ref|YP_003842462.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873829|ref|YP_003842462.1|
Domain Number 1 Region: 36-74,112-523
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.16e-134
Family Cellulases catalytic domain 0.0000000149
Further Details:      
 
Domain Number 2 Region: 540-697
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 8.37e-38
Family Cellulose-binding domain family III 0.00023
Further Details:      
 
Domain Number 3 Region: 702-763
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000432
Family Type I dockerin domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302873829|ref|YP_003842462.1|
Sequence length 764
Comment glycoside hydrolase family protein [Clostridium cellulovorans 743B]
Sequence
MKVKQLVKKTTVSVATLAIFSTMLGVQAHSETVSKTYNYAEAFQKSMYFYDAEKCGAGIT
GGKLEWRGDCHTDDAKIPLVPAGKGADGAMAEKGVSLTQEFIDANRKYLDPDGDGTVDLS
GGFHDAGDHVKFGLPGSYAAATLGWGFYEFKDAYARIGEEAHMRDLLKWYSDYFLRCTFM
NENGEVVAFCYQVGEGSSDHSYWGAPELQPTLRPAYFATPQTPASDQVAGAAAALAIMYL
NTKDTDAAYAEKCLSTSKALYNFAVKYRGLGYSGGFYGSSYDEDELSWAAVWLNIATGEK
SYINDIVEVSPDGRYLGYLGKIIKSTQDDWQNIWCHSWDVVWGGVFAKLAPITNTERDWY
IFRWNIEYWSGVPHEDPSDKTFMAATPGGFKVVNTWGSARYNSAEQLCALVYKKETGSSD
FDAWVKSQMNYILGDNPLNRCYEVGYAENSAKHPHHRAAHGSITNNMGVPNEHRHTLWGA
LVGGPDQTDSHKDDTTDFVGNEVAVDYNAGFVGALAGITKYFGQDQMPLENFPLKEAPVD
EFFVESKLEQENGERTQVTIRANNLTVHPPHTEDTIKVRYFFNISELMQYNQGIDAITCP
VMYDQSNTVDVKGATISAPVEWDKEKGIYYVEIDWSGNAIYGSREFHFGLVTGQDSNWKA
HWDPTNDWSRQGVTEEYAQNPHISMYVNGKKVFGEEPTTKVLVIKGDADGNGKVTAIDLA
YIKKYILGQGSIIFPGGIEVVDMNGDGVINAIDLALLKKALLGL
Download sequence
Identical sequences A0A173MZM6 D9ST82
WP_010076457.1.47838 gi|302873829|ref|YP_003842462.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]