SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873844|ref|YP_003842477.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873844|ref|YP_003842477.1|
Domain Number 1 Region: 529-634
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.91e-19
Family Histidine kinase 0.0063
Further Details:      
 
Domain Number 2 Region: 67-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000357
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302873844|ref|YP_003842477.1|
Sequence length 640
Comment signal transduction histidine kinase LytS [Clostridium cellulovorans 743B]
Sequence
MLLYSKIHYLLYEKNKFLVLKTTLSIFIIVLMSVVFSGCTEHQSTDKKPPKAINGKFELS
DWDFQKEGAILLNGQWEFYWNKLLYPEDFNQSTVSHKNHIVAVPTSWRNYQIEDKKLPNE
GYATYRLLVDLDYIPQDLAINTKAFISTCRIWVDNKEIFQTGVVSDNPNTSKDRFKPQLI
TIHPQNKQFYITVQISNFGCAYGGFVTGLELGNIHLLNNENNKQAYVDMFLFGSILIMGL
YHITLYLLRRKDCSTLYFGIICLLIAIRTLLMGQMLLYSFLPSVPLHIFLKLSMITLYLA
LTFFVMFIHIVFPLDTPRWFVRFSQAIGLFFFTTAIIFTEKLGNLFIVPYEIISVFILIV
LLSVLIKAFLKKRESSILVLSAVLFIILIAINDILNSYGVISTGFFIPFGVFIFIFVQSF
MLSRKFAKAFFHEEQLLKSELRMLQAQIKPHFLFNTLNTIICVCRESSEKAEELLLNLSN
YLRCGFSFKNDDEFADLETELLHVKSYLHIEKARFLDKLNIIFDIDTNIHCKVPAYIIQP
IVENSVRHGILPCKDGGTVRLTVKKNNNMLIIIVEDDGVGMTEEKLTALLNSSDKKAGIG
ISNIQNRIQRIYGKSIKIKSTKGIGTIVTLELPLSDALNL
Download sequence
Identical sequences D9ST97
gi|302873844|ref|YP_003842477.1| WP_010076442.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]